SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125973247|ref|YP_001037157.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125973247|ref|YP_001037157.1|
Domain Number 1 Region: 31-98
Classification Level Classification E-value
Superfamily Type I dockerin domain 1.7e-20
Family Type I dockerin domain 0.00028
Further Details:      
 
Weak hits

Sequence:  gi|125973247|ref|YP_001037157.1|
Domain Number - Region: 141-179,225-252,325-474
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00141
Family Quinoprotein alcohol dehydrogenase-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|125973247|ref|YP_001037157.1|
Sequence length 537
Comment dockerin type I cellulosome protein [Clostridium thermocellum ATCC 27405]
Sequence
MRMLKKCTGFFLYVLVLLVNIISVSALEPPPIYGDSNSDCKVNSTDLTLMKRYLLQQSIS
YINLINADLNGDGKINSSDYTLLKRYLLGYIDSFPVENQYPTTPEPSPTPTPAVDEEAWK
NNTGTIELGDTIKVSGEGISVNGSVVTITAGGDHLVTGTLNNGMIFVNTTERVKLRLSGV
NIKNPNGPAIYFYNVDKGFITIEKGTVNYLSDGSTYTDQDAKAALFSNDDLELKGKGTLY
VTGNYKHGIASDDDLIIENGDIYVTAVTDGLHANSGIEIKGGNITVTAKSDAIESEKDFE
MTGGTLNLTADDDAIHSEKDLVIDDGEINILKCYEGIESKTTITINGGKININSNEDGLN
AASGLYINGGELYITSGYDGIDSNGPIYINGGYIFSFGGNIPEGGIDCDWNPLIINGGTL
IAAGGSNSTPSTSSTQCSVLLGSGTANSVISIQRNGSEIISFTAPKNYQNMVFSSPDLVL
NATYVVYRNGVQSVTFTTNSIVTNAGGSSGGWFPGGGFPGGGFPGGGGGWFPGGPGW
Download sequence
Identical sequences A3DDD5
203119.Cthe_0729 gi|125973247|ref|YP_001037157.1| gi|385778842|ref|YP_005688007.1| WP_003516254.1.16390 WP_003516254.1.19387 WP_003516254.1.20586 WP_003516254.1.31213 WP_003516254.1.55520 WP_003516254.1.60145 WP_003516254.1.6636 WP_003516254.1.6965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]