SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125973263|ref|YP_001037173.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125973263|ref|YP_001037173.1|
Domain Number 1 Region: 30-480
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 7.18e-166
Family Cellulases catalytic domain 0.0000000000037
Further Details:      
 
Domain Number 2 Region: 485-640
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 2.04e-46
Family Cellulose-binding domain family III 0.0000121
Further Details:      
 
Domain Number 3 Region: 663-728
Classification Level Classification E-value
Superfamily Type I dockerin domain 4.84e-18
Family Type I dockerin domain 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|125973263|ref|YP_001037173.1|
Sequence length 730
Comment glycoside hydrolase family protein [Clostridium thermocellum ATCC 27405]
Sequence
MKKFLSLILVVSFLIMLLTPSTKISAATTFNYGEALQKAIMFYEFQRSGKLPSTIRNNWR
ADSCLDDGKDVGLDLTGGWFDAGDHVKFNLPMAYTAAMLAWAVYEEKDAFVKSGQLKYIL
DEIKWATDYFIKCHPEPDVYYYQVGDGDIDHMWWGPAEVVHLRTKRPSYKVDITSPGSTV
SAETAAALAAASIVFKDTDPQYSNLCLKHAKELFNFADKTRSDAGYTAATNFYTSHSGFY
DELTWAATWIYLATGDTSYLDKAESYVEFWSTEPQTDIMSYKWGHCWDDVRYGAQLLLAR
ITNKPIYKESMERHLDYWTVGVDNSRIKYTPKGLAWLNNWGSLRYATTTAFLAAVYADWE
GCSPQKAKIYNDFAKAQVDYALGSTGRSFVVGFGENWPQHPHHRTAHGSWYDSMNVPDYH
RHVLYGALVGGPGESDNYRDDISDYQCNEVACDYNAGFVGALAKMYNRYDGRPVPEFKAI
EVPEDEFMVEAYVSSSDKNYVEIKTRLNNRTAWPARVSEGLSFRYFIDLTEVIEAGYGPN
DLIISGGQGSSGKVSGPHLWNKEKNIYYIEVDYTGDRLFPGGQDHYRRDSSLRIAVPGNS
GCWNSENDPSFKGLSKTSEFKKAEYIPVYEYGVKVAGIEPEGTVVQPSPSPTPTPTPPHS
DDVLYGDINNDKTVNSTDVTYLKRFLLKQINSLPNQKAADVNLDGNINSTDLVILKRYVL
RGISKLPYAP
Download sequence
Identical sequences A3DDF1
gi|125973263|ref|YP_001037173.1| gi|385778825|ref|YP_005687990.1| WP_003516278.1.16390 WP_003516278.1.19387 WP_003516278.1.31213 WP_003516278.1.55520 WP_003516278.1.60145 WP_003516278.1.6636 WP_003516278.1.6965 203119.Cthe_0745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]