SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125973343|ref|YP_001037253.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125973343|ref|YP_001037253.1|
Domain Number 1 Region: 137-573
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 1.42e-125
Family Cellulases catalytic domain 0.0000000000000334
Further Details:      
 
Domain Number 2 Region: 38-134
Classification Level Classification E-value
Superfamily E set domains 3.85e-25
Family E-set domains of sugar-utilizing enzymes 0.00000279
Further Details:      
 
Domain Number 3 Region: 580-648
Classification Level Classification E-value
Superfamily Type I dockerin domain 1.77e-18
Family Type I dockerin domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|125973343|ref|YP_001037253.1|
Sequence length 649
Comment glycoside hydrolase family protein [Clostridium thermocellum ATCC 27405]
Sequence
MSRMTLKSSMKKRVLSLLIAVVFLSLTGVFPSGLIETKVSAAKITENYQFDSRIRLNSIG
FIPNHSKKATIAANCSTFYVVKEDGTIVYTGTATSMFDNDTKETVYIADFSSVNEEGTYY
LAVPGVGKSVNFKIAMNVYEDAFKTAMLGMYLLRCGTSVSATYNGIHYSHGPCHTNDAYL
DYINGQHTKKDSTKGWHDAGDYNKYVVNAGITVGSMFLAWEHFKDQLEPVALEIPEKNNS
IPDFLDELKYEIDWILTMQYPDGSGRVAHKVSTRNFGGFIMPENEHDERFFVPWSSAATA
DFVAMTAMAARIFRPYDPQYAEKCINAAKVSYEFLKNNPANVFANQSGFSTGEYATVSDA
DDRLWAAAEMWETLGDEEYLRDFENRAAQFSKKIEADFDWDNVANLGMFTYLLSERPGKN
PALVQSIKDSLLSTADSIVRTSQNHGYGRTLGTTYYWGCNGTVVRQTMILQVANKISPNN
DYVNAALDAISHVFGRNYYNRSYVTGLGINPPMNPHDRRSGADGIWEPWPGYLVGGGWPG
PKDWVDIQDSYQTNEIAINWNAALIYALAGFVNYNSAQNEVLYGDVNDDGKVNSTDLTLL
KRYVLKAVSTLPSSKAEKNADVNRDGRVNSSDVTILSRYLIRVIEKLPI
Download sequence
Identical sequences A3DDN1
WP_011837914.1.31213 gi|125973343|ref|YP_001037253.1| Cth-2210 203119.Cthe_0825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]