SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125973429|ref|YP_001037339.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125973429|ref|YP_001037339.1|
Domain Number 1 Region: 192-542
Classification Level Classification E-value
Superfamily (Trans)glycosidases 9.2e-81
Family beta-glycanases 0.00000215
Further Details:      
 
Domain Number 2 Region: 566-710
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.76e-37
Family CBM22 0.000000078
Further Details:      
 
Domain Number 3 Region: 33-182
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.96e-25
Family CBM22 0.0072
Further Details:      
 
Domain Number 4 Region: 828-1075
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 5.91e-25
Family Carboxylesterase 0.0000000000895
Further Details:      
 
Domain Number 5 Region: 729-797
Classification Level Classification E-value
Superfamily Type I dockerin domain 5e-18
Family Type I dockerin domain 0.0000574
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|125973429|ref|YP_001037339.1|
Sequence length 1077
Comment glycoside hydrolase family protein [Clostridium thermocellum ATCC 27405]
Sequence
MKNKRVLAKITALVVLLGVFFVLPSNISQLYADYEVVHDTFEVNFDGWCNLGVDTYLTAV
ENEGNNGTRGMMVINRSSASDGAYSEKGFYLDGGVEYKYSVFVKHNGTGTETFKLSVSYL
DSETEEENKEVIATKDVVAGEWTEISAKYKAPKTAVNITLSITTDSTVDFIFDDVTITRK
GMAEANTVYAANAVLKDMYANYFRVGSVLNSGTVNNSSIKALILREFNSITCENEMKPDA
TLVQSGSTNTNIRVSLNRAASILNFCAQNNIAVRGHTLVWHSQTPQWFFKDNFQDNGNWV
SQSVMDQRLESYIKNMFAEIQRQYPSLNLYAYDVVNEAVSDDANRTRYYGGAREPGYGNG
RSPWVQIYGDNKFIEKAFTYARKYAPANCKLYYNDYNEYWDHKRDCIASICANLYNKGLL
DGVGMQSHINADMNGFSGIQNYKAALQKYINIGCDVQITELDISTENGKFSLQQQADKYK
AVFQAAVDINRTSSKGKVTAVCVWGPNDANTWLGSQNAPLLFNANNQPKPAYNAVASIIP
QSEWGDGNNPAGGGGGGKPEEPDANGYYYHDTFEGSVGQWTARGPAEVLLSGRTAYKGSE
SLLVRNRTAAWNGAQRALNPRTFVPGNTYCFSVVASFIEGASSTTFCMKLQYVDGSGTQR
YDTIDMKTVGPNQWVHLYNPQYRIPSDATDMYVYVETADDTINFYIDEAIGAVAGTVIEG
PAPQPTQPPVLLGDVNGDGTINSTDLTMLKRSVLRAITLTDDAKARADVDKNGSINSTDV
LLLSRYLLRVIDKFPVAENPSSSFKYESAVQYRPAPDSYLNPCPQAGRIVKETYTGINGT
KSLNVYLPYGYDPNKKYNIFYLMHGGGENENTIFSNDVKLQNILDHAIMNGELEPLIVVT
PTFNGGNCTAQNFYQEFRQNVIPFVESKYSTYAESTTPQGIAASRMHRGFGGFSMGGLTT
WYVMVNCLDYVAYFMPLSGDYWYGNSPQDKANSIAEAINRSGLSKREYFVFAATGSEDIA
YANMNPQIEAMKALPHFDYTSDFSKGNFYFLVAPGATHWWGYVRHYIYDALPYFFHE
Download sequence
Identical sequences A3DDW7
Cth-1224 gi|125973429|ref|YP_001037339.1| gi|385778654|ref|YP_005687819.1| WP_003517278.1.16390 WP_003517278.1.19387 WP_003517278.1.20586 WP_003517278.1.31213 WP_003517278.1.55520 WP_003517278.1.60145 WP_003517278.1.6636 WP_003517278.1.6965 203119.Cthe_0912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]