SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125973432|ref|YP_001037342.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|125973432|ref|YP_001037342.1|
Domain Number - Region: 120-191
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0034
Family Galactose-binding domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|125973432|ref|YP_001037342.1|
Sequence length 400
Comment hypothetical protein Cthe_0915 [Clostridium thermocellum ATCC 27405]
Sequence
MIKRIVISLVLFILLFVSNAYAVDFSYSARIENGGSKKYKAIRITPKIYNNINANMADLV
LYDENNEPVPYFINSFKEIKTETQKSYAMKLVNSFVKDEYYYLDYALEEFPDEDIIATSI
EIKTENSGFAKRVEVFGSYDNVNWEKVKEDILYSVEGIKKLEIQFDSIKKYTHYRFKISN
NLEKISFSSVELKYNLVYHEKEYFTETLSPEYNVAEQENKTVIKIKDLKNLKVTGITLKT
DSTFKREVTFDGRISKTLYNLNFNGMQYTDLTIAVEPYRITSDTAELVIDNKDDKPINVE
GIEIEYLFDELVFEGSGSKEYVLKFGNNEILTPKSYDISNYKEYILDEGYDILNIREIVE
LPRKEPETKPPEYDYKLIFNISIILVAVIMAVIIFLKIKK
Download sequence
Identical sequences A3DDX0
WP_004463412.1.16390 WP_004463412.1.31213 WP_004463412.1.60145 203119.Cthe_0915 gi|125973432|ref|YP_001037342.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]