SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125973751|ref|YP_001037661.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125973751|ref|YP_001037661.1|
Domain Number 1 Region: 47-140
Classification Level Classification E-value
Superfamily Fibronectin type III 4e-20
Family Fibronectin type III 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|125973751|ref|YP_001037661.1|
Sequence length 235
Comment fibronectin, type III [Clostridium thermocellum ATCC 27405]
Sequence
MTFDVPSFFPYRIQQVYAEKEQIDSGESVAESVYKKIETYDDIPVDIEPPKPPANLQLIS
KTSSTVSMSWSPAEDNTGVSYYNIYNGSSVVQAVYGENTSCTVSGLLPFTQYSFTVRAVD
ESGNVSAPSNTLVVTTLRESIRVNSNMALFEDKIYQDLYLESGSLNLNGYNLTIEGNLIH
SGGTLNINGGKLIVKGDYRIQKESVNAQGQVTYSGSDGYLYMRRRMIMFAWKGIL
Download sequence
Identical sequences A3DET9
gi|125973751|ref|YP_001037661.1| 203119.Cthe_1236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]