SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125973771|ref|YP_001037681.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125973771|ref|YP_001037681.1|
Domain Number 1 Region: 5-315
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.37e-96
Family NagZ-like 0.0000716
Further Details:      
 
Domain Number 2 Region: 316-553
Classification Level Classification E-value
Superfamily Beta-D-glucan exohydrolase, C-terminal domain 8.63e-59
Family Beta-D-glucan exohydrolase, C-terminal domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|125973771|ref|YP_001037681.1|
Sequence length 755
Comment glycoside hydrolase family protein [Clostridium thermocellum ATCC 27405]
Sequence
MAVDIKKIIKQMTLEEKAGLCSGLDFWHTKPVERLGIPSIMMTDGPHGLRKQREDAEIAD
INNSVPATCFPSAAGLACSWDRELVERVGAALGEECQAENVSILLGPGANIKRSPLCGRN
FEYFSEDPYLSSELAASHIKGVQSQGVGACLKHFAANNQEHRRMTVDTIVDERTLREIYF
ASFENAVKKARPWVVMCAYNKLNGEYCSENRYLLTEVLKNEWMHDGFVVSDWGAVNDRVS
GLDAGLDLEMPTSHGITDKKIVEAVKSGKLSENILNRAVERILKVIFMALENKKENAQYD
KDAHHRLARQAAAESMVLLKNEDDVLPLKKSGTIALIGAFVKKPRYQGSGSSHITPTRLD
DIYEEIKKAGGDKVNLVYSEGYRLENDGIDEELINEAKKAASSSDVAVVFAGLPDEYESE
GFDRTHMSIPENQNRLIEAVAEVQSNIVVVLLNGSPVEMPWIDKVKSVLEAYLGGQALGG
ALADVLFGEVNPSGKLAETFPVKLSHNPSYLNFPGEDDRVEYKEGLFVGYRYYDTKGIEP
LFPFGHGLSYTKFEYSDISVDKKDVSDNSIINVSVKVKNVGKMAGKEIVQLYVKDVKSSV
RRPEKELKGFEKVFLNPGEEKTVTFTLDKRAFAYYNTQIKDWHVESGEFLILIGRSSRDI
VLKESVRVNSTVKIRKRFTVNSAVEDVMSDSSAAAVLGPVLKEITDALQIDMDNAHDMMA
ANIKNMPLRSLVGYSQGRLSEEMLEELVDKINNVE
Download sequence
Identical sequences P14002
WP_003517480.1.16390 WP_003517480.1.19387 WP_003517480.1.20586 WP_003517480.1.31213 WP_003517480.1.55520 WP_003517480.1.60145 WP_003517480.1.6636 WP_003517480.1.6965 gi|385778356|ref|YP_005687521.1| gi|125973771|ref|YP_001037681.1| 203119.Cthe_1256 CmR59

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]