SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125973877|ref|YP_001037787.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125973877|ref|YP_001037787.1|
Domain Number 1 Region: 1-111
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 1.12e-22
Family N-utilization substance G protein NusG, N-terminal domain 0.0027
Further Details:      
 
Domain Number 2 Region: 120-172
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.000000662
Family N-utilization substance G protein NusG, C-terminal domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|125973877|ref|YP_001037787.1|
Sequence length 185
Comment NusG antitermination factor [Clostridium thermocellum ATCC 27405]
Sequence
MYWYVLFVKSGKERKVEQYLRKELNADISIPFIPLQEILFKKAGSVKKEIRPLFPGYVFV
ESMLPGRDFLEEIKYLINRSSDIISLLKYSDTEIAMRESERQRLLSLCNNNYCIEASYGI
IEGDKILIFDGPLKGMESLVKKINRHRREALIEIEIMGDVRLVTVALEVVRKVSDNENNV
RCRTT
Download sequence
Identical sequences A3DF65
WP_003517110.1.16390 WP_003517110.1.19387 WP_003517110.1.20586 WP_003517110.1.31213 WP_003517110.1.55520 WP_003517110.1.6636 WP_003517110.1.6965 203119.Cthe_1362 gi|125973877|ref|YP_001037787.1| gi|385778245|ref|YP_005687410.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]