SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125973879|ref|YP_001037789.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125973879|ref|YP_001037789.1|
Domain Number 1 Region: 69-249
Classification Level Classification E-value
Superfamily SGNH hydrolase 1.83e-24
Family TAP-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|125973879|ref|YP_001037789.1|
Sequence length 392
Comment hypothetical protein Cthe_1364 [Clostridium thermocellum ATCC 27405]
Sequence
MWKNAIYLFSSILIASLVILISGRYLDGISGSYLGEQKQRLEVQTEYQTELEKVQAGNVY
EKLVNKKEISVLIIGDDIAQGGLETEDEKKWYNLLAKRIKEEYGADLTCKNIATPGGTAF
DGWIDYITDRERQEYDLVFLCFGANDEREMNFNQKVFGAIVEGLIRNIKKAKASTEIITI
IENSIRSQSYVDTLKQVSEYYEITYADIIKAFIDSRLPFNDITEDGRKPNEQGYSIYVNT
IFDLIKSNINSKREPGFDGKKPLLYEESNAFENGKITTEFLTIQGFYNSVVAFDKIFMKS
SHSNDSITYEVSNSHMLGVTLMAGPNCGIVDIYLNNRLIQTYDCYAPYEALRHVLISDNI
GMGTHKIRIEVSSIKNAKASNSNVYIHGIITN
Download sequence
Identical sequences A3DF67
WP_011838064.1.31213 gi|125973879|ref|YP_001037789.1| 203119.Cthe_1364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]