SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125973942|ref|YP_001037852.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125973942|ref|YP_001037852.1|
Domain Number 1 Region: 6-425
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.1e-122
Family Family 1 of glycosyl hydrolase 0.000000221
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|125973942|ref|YP_001037852.1|
Sequence length 442
Comment glycoside hydrolase family protein [Clostridium thermocellum ATCC 27405]
Sequence
MVTFKLNDEFMFGTATASTQIEGGDTGNTWYKWCQEGRIKDSSSCITACDHWNRVEEDTE
LLKNLGVQTHRMSLEWSRIEPSRGKFSDDAMKHYRDEIKLLVENNIKPLVTLHHFSEPIW
FHEMGGWKKTGNADIFIEYVKYVVENLGDLVSDWVTFNEPNVYVDFGYVIGIFPPGERSL
SEGLKVTAELINTHVKLYRLIHRIRRERKFAGRTMVGTAMHLRIFDGISSTGKMIAKVVD
YLFNEMFMEGMTTGHMMFPLSKKGSSHKKGRYADFLGINYYTRNIVEFVFDPSLYFHELV
CDKDLTKSDLGWDIYPEGIYKVCKRYYKKYKLPIYITENGISDKNDTKRPSFIASHLAYI
AKAIKEGIPIERYYYWTLMDNFEWLEGESTDFGLYDCNFRTQERIPRKSVRLYEQICRRK
ELTAEMIEDFKKYSGITIETIR
Download sequence
Identical sequences A3DFD0
Cth-1324 WP_003519462.1.16390 WP_003519462.1.19387 WP_003519462.1.20586 WP_003519462.1.31213 WP_003519462.1.55520 WP_003519462.1.60145 WP_003519462.1.6636 WP_003519462.1.6965 203119.Cthe_1428 gi|125973942|ref|YP_001037852.1| gi|385778175|ref|YP_005687340.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]