SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125973948|ref|YP_001037858.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125973948|ref|YP_001037858.1|
Domain Number 1 Region: 8-161
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.0000000206
Family YiiX-like 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|125973948|ref|YP_001037858.1|
Sequence length 196
Comment hypothetical protein Cthe_1434 [Clostridium thermocellum ATCC 27405]
Sequence
MEKFYVYVVLTRTNTVISRLIQLFKKDEFTHAAISLDRDLANMYSFGRKYTFNPFIGVFK
HENLNKGTYKYCKVLPGAVIELEVTKQQYQRAKALLQCFISNAGRYKYNYMGLVNGLLNR
EACHDSRFVCSEFVYYILNESGIADFKISRNLVRPQSLLKLNGRIIFKGDLKNTRLLKKC
LRSHKIHVNQKLSVAL
Download sequence
Identical sequences A3DFD6
gi|385778169|ref|YP_005687334.1| gi|125973948|ref|YP_001037858.1| WP_003519182.1.16390 WP_003519182.1.19387 WP_003519182.1.20586 WP_003519182.1.31213 WP_003519182.1.55520 WP_003519182.1.60145 WP_003519182.1.6636 WP_003519182.1.6965 203119.Cthe_1434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]