SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125973983|ref|YP_001037893.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125973983|ref|YP_001037893.1|
Domain Number 1 Region: 138-485
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.24e-41
Family beta-glycanases 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|125973983|ref|YP_001037893.1|
Sequence length 561
Comment glycoside hydrolase family protein [Clostridium thermocellum ATCC 27405]
Sequence
MKCRYMDYLINCELDSLPNEKSEKINKHISTCMDCRNYLGALMISKKYIAKEPEMDKYFY
MRVINAIDPDRYKKSKLTFKILSSLERLKPAFKASLGTLAIFVAVALLITGGIFDNLGNW
IAKSSNNRSNTGETTNLTFLRTDGQNIVTGTGEIFHIRGVTLTNNFWGNWVNGESEKLQS
QGMDPIIRPLVQDAWVLTDDDFERIKDLGCNTVLYDINYQLFAEDNPNREENLKKLKEHI
RRFSSMDIYTAVMLMAPPGLDSINDAYEKYKHGSERIKSVFEDDTYYEQWVEMWKYLAEE
LKDFKGVAGYGLINQPRAPSESEGGIGIFRERLNNVCREIRKIDKNHIIFVPEYNSREAN
PGESYWNEKTNSYVIDNGEQGIIWERGLVKVDSSNVVYLFHFFEPYNFVNDGVGDFDAES
LEAQVRKRYEWAKNVGRAPLLTEYGISRVNSVDKRVQWLETVHDIFDKYGISASYFQYKN
AVGAFINVKTGFNALYGEYVSWDSEIGLNPFYFVNEHVATSAKENHFDEALKEYYLKGKN
LKKISILDNQPILETLQNFWK
Download sequence
Identical sequences A3DFH1 H6SHY3
NYSGXRC-11095o 203119.Cthe_1471 WP_011838088.1.31213 gi|125973983|ref|YP_001037893.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]