SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125974120|ref|YP_001038030.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125974120|ref|YP_001038030.1|
Domain Number 1 Region: 10-213,767-800
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.09e-21
Family Type II chitinase 0.014
Further Details:      
 
Weak hits

Sequence:  gi|125974120|ref|YP_001038030.1|
Domain Number - Region: 465-520
Classification Level Classification E-value
Superfamily FomD-like 0.0876
Family FomD-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|125974120|ref|YP_001038030.1|
Sequence length 807
Comment glycosyl hydrolase-like protein [Clostridium thermocellum ATCC 27405]
Sequence
MGNARMYEALRDYGDRFDTVGIFTFEVDETGTITETGTSISSMLPYIQKWPHIKWLLTIM
NHGIANIFTALRNNENGAKDKFLTEIIRIMNKYPWCAGVDIDLERGGGYENKDAANALFR
DIYNTVKSYDATKLVNICLPGMIGVQGSVGGENWCVYADLNDYCDTAAIMSYGMAWAGSA
PGPVSPRDWLEGIYDYAVSVMSPDKIFMGLPAYGWNWRIHDTPENLGITYRGVSNTYYAA
KYWMTGVYNFTGDAPPQPFIPIVAYWDDYNKVPWALPHVYDYMEGWDAVSWEYPLLKGVY
NRRRYLTSYGKEQKAEFGTIYIDRNGVPDEYEGNVIITDEMTSLGDAQASAEYRFEIREA
GYYDIAVQLCFPYWDKNAIIVSLDGISKTFSENRLWWPYWRRVCWLTLAKGVFLQEGTHA
ISISGGVPGVQFYGFRVCSGFSEYPFAGEASFMLSPRRFKDVNGVMVEPDRGFKLTFEML
RRKPDSALIWYEDFRDRNILPENYWTVLDGEWDVWQDPDSTENRPYSQLEGYGKLAWKYD
GFSDIHIRARLAFPQNSSGRAGVFLGDIFCCLNYDTQRVELYQGNSLLGSYSTSFSKTVD
ADLRANPNMYTIEMRKRGNKVRVYSGAASTLRFTVNVTGGSGYVGYCSDNRTVCELLRLG
DAWVYEPYERFDVELPDGNITSFGRLARTGVTWDDEFQVFSVNNDVEESITRSEDISMDY
DFFHSQLLALSCGNDYEVKIILKDINIWISRLFLGDADGFSILYYQDVDSLVYWANEAAY
RWKLRGIAIWSLGQEDMRLWEALPKQI
Download sequence
Identical sequences A3DFV8
gi|125974120|ref|YP_001038030.1| NYSGXRC-11095p 203119.Cthe_1613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]