SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125974123|ref|YP_001038033.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125974123|ref|YP_001038033.1|
Domain Number 1 Region: 17-179
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000259
Family Glycosyl hydrolases family 16 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|125974123|ref|YP_001038033.1|
Sequence length 840
Comment phage minor structural protein [Clostridium thermocellum ATCC 27405]
Sequence
MAIKSILTSQEDFTGEFPVTSRTSALWRFNEKTPDENLLLMDSSGHGRHFTISGWSGTSA
NLIAGRFGRYFRQNIVNPTSEKTHLIAENDGSFFSNLGEKIVVGGWINPTTYSVGQTYIS
IFNTRQGPGQPILYVSLYQGRLRLMLYNSSGTLIYDQSETATITLKNGGWYFIASIIEVN
NKKVQNIICDRSDGATWVSPVRSFSGELNRECIADIIMGMHANTYYYAGGFDDWFLETDS
QLTADDLLLYFKSSLQANGGDAASDVDALAEPGAVTLKATDGEYPASGVLYTRAVPCALS
GSGRVAVTSEYTAGVTSVSLVETSTSDDLEEWSAWQAVGTSGELQSPNRQYIRFRVTLTS
SDPLKTPKLLEIQLHDIPKAPYEKLGFARPVILDKNGAWEAVLENAFDIIVTGEVNGADT
LEFKLPFHDPKRSTLENEKQVQIVNDIYRIRTLTDNKGEDGRVITQVYAEAVFYDLSFSA
EKEPREFNADTADVPMQYALLGTGWTVGNVTVTTKRTWQCTEKNALSILRTVQNIYGGDL
VFDSANRQVHLLTFSGTDSGALFSYRKNLKSIQRVVDTRELVTKLYAYGKDGLTFASING
GKEYVEDYTFSSEVRVSTLDCSSFTNPYQMLEYAKMRLAEYSKPRVSYVLSAMDLSALTG
YEHEAWKLGDIVTVDDKELGLLVKTRVVRRQYNLQEPWKTVIELSTKLRELGDSSAQWDK
AADALSSAELINRQEIKDMVPFNHLRNSRADDGFAYWVNSGFEVDTENGVSGTASFKAVG
VPGMKKSLSQTVYPATRKSYTFSAQIASESLEKGENGQVGVEIVIEYEDGTTETRFIDLI
Download sequence
Identical sequences A3DFW1
203119.Cthe_1616 WP_011838144.1.31213 gi|125974123|ref|YP_001038033.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]