SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125974342|ref|YP_001038252.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125974342|ref|YP_001038252.1|
Domain Number 1 Region: 194-544
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.32e-88
Family beta-glycanases 0.00000149
Further Details:      
 
Domain Number 2 Region: 35-189
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.08e-41
Family CBM22 0.00063
Further Details:      
 
Domain Number 3 Region: 554-617
Classification Level Classification E-value
Superfamily Type I dockerin domain 8.93e-17
Family Type I dockerin domain 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|125974342|ref|YP_001038252.1|
Sequence length 619
Comment glycoside hydrolase family protein [Clostridium thermocellum ATCC 27405]
Sequence
MLKKKLLTLLTVFALLTVGICGSFLPLPKASAAALIYDDFETGLNGWGPRGPETVELTTE
EAYSGRYSLKVSGRTSTWNGPMVDKTDVLTLGESYKLGVYVKFVGDSYSNEQRFSLQLQY
NDGAGDVYQNIKTATVYKGTWTLLEGQLTVPSHAKDVKIYVETEFKNSPSPQDLMDFYID
DFTATPANLPEIEKDIPSLKDVFAGYFKVGGAATVAELAPKPAKELFLKHYNSLTFGNEL
KPESVLDYDATIAYMEANGGDQVNPQITLRAARPLLEFAKEHNIPVRGHTLVWHSQTPDW
FFRENYSQDENAPWASKEVMLQRLENYIKNLMEALATEYPTVKFYAWDVVNEAVDPNTSD
GMRTPGSNNKNPGSSLWMQTVGRDFIVKAFEYARKYAPADCKLFYNDYNEYEDRKCDFII
EILTELKAKGLVDGMGMQSHWVMDYPSISMFEKSIRRYAALGLEIQLTELDIRNPDNSQW
ALERQANRYKELVTKLVDLKKEGINITALVFWGITDATSWLGGYPLLFDAEYKAKPAFYA
IVNSVPPLPTEPPVQVIPGDVNGDGRVNSSDLTLMKRYLLKSISDFPTPEGKIAADLNED
GKVNSTDLLALKKLVLREL
Download sequence
Identical sequences A3DGI0 O32374
Cth-2387 WP_003513765.1.19387 WP_003513765.1.20586 WP_003513765.1.31213 WP_003513765.1.55520 WP_003513765.1.60145 WP_003513765.1.6636 WP_003513765.1.6965 gi|125974342|ref|YP_001038252.1| 203119.Cthe_1838 gi|385779820|ref|YP_005688985.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]