SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125974394|ref|YP_001038304.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125974394|ref|YP_001038304.1|
Domain Number 1 Region: 27-94
Classification Level Classification E-value
Superfamily Type I dockerin domain 1.96e-19
Family Type I dockerin domain 0.00031
Further Details:      
 
Domain Number 2 Region: 154-280,386-598
Classification Level Classification E-value
Superfamily RNI-like 0.00000000439
Family Cyclin A/CDK2-associated p19, Skp2 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|125974394|ref|YP_001038304.1|
Sequence length 710
Comment dockerin type I cellulosome protein [Clostridium thermocellum ATCC 27405]
Sequence
MRKKGLLLLLTVIAATIVVSMMSAGATTLYGDLNADGSINSTDLMIMKRVLLKQRTLDDI
TPADLNGDGKVTSTDYSLMKRYLLKEIDKFPVEDIEPTPTLEVSPTPTETSEEVFAFKIK
LFSDGDTYRFPIQEISENNNIVVDWGDGTTSTITDYSTLRHKYEKAGVYTIKVLWFDHIP
IRFTGDKYVIEILTPLPDIGLTDFSSFFKNCSNLERIPDRLFSNNINATDFNFCFSGCTS
LTEIPESLFAGNVNATTFVRCFYRCSNLIKVPEGLFENNVNATNFLGCFDECSSLKEIPE
GLFSNNVNAANFSWCFSECVSLAKIPEGLFRNNTNATDFSYCFYGCTSITKIPGGLFENN
INAEDFGNCFSGCSSITEIPGGLFENNINAANFGSCFSGCSSITEIPEGLFENNINAEDF
RGCFSGCSSIMEIPEGLFKNNINAEDFRGCFSGCSSITEIPGGLFENNINAEDFGGCFSG
CSSITEIPGGLFENNINASDFSSCFSGCSSITEIPGGLFRNNINTTRFMECFKGCSSVTE
IPEELFANNVDTAIFIGCFSECISLRKIPEGLFKNNINVISFMECFKGCSNLTEIPEGLF
VNNTNATDFQGCFYGCSSLTEIPARLFTNNVNVTNFRECFRDCTSLIEIPESLFDSNVNV
TNFYRCFYGCKNLTGVAPALWLRTNVKEFSGCFGSCTKLSNYNDIPKGWK
Download sequence
Identical sequences A3DGN2
WP_011838289.1.31213 gi|125974394|ref|YP_001038304.1| 203119.Cthe_1890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]