SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125974413|ref|YP_001038323.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125974413|ref|YP_001038323.1|
Domain Number 1 Region: 86-219
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.72e-32
Family Family 6 carbohydrate binding module, CBM6 0.00033
Further Details:      
 
Domain Number 2 Region: 239-325
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000884
Family Family 6 carbohydrate binding module, CBM6 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|125974413|ref|YP_001038323.1|
Sequence length 1290
Comment carbohydrate-binding family 6 protein [Clostridium thermocellum ATCC 27405]
Sequence
MRRGKLRKIIALVLVLGFIAGNFAVTTFAAETVKPYCTRTSTPVMAVNLGSNEDVSHGGT
NFKKQSAYSNLKVEVKGPSDSAYPTGTINALSVIQAENCDENHGLEIEDCPDEGGTKNLA
YIANGDYTAYYNVYFPKGTKGFIARVSSDTEGGYIELRLDSISAEVVGRCRVENTGGWEK
YEEVYCELNKSVEGVHTLYMGFAGERDGLFNVNWFRFTKSPYEPVMTKSRDGAVDGAYLY
KFIDFGKESIPTRFKMHLSGSISGIINVRLDSPSGDVIATVDGTNGAGEVEGRVEKPVTG
IHELYLTDDKNGTLISKVDWFVFEPEESKEITDRNLQNFAKTSVKGYNVNLEASLDKNNV
YEVYIHPVEFRKKNRQIFDLYINGTLVDTIDTEESGLDWEKKGPYITKVLDDGKLKIECK
SRQGIVSLAGLEINKITYSKAFSDVKIKDWFYIPVMELASRGVIFGKGNDMFKPQDHIIG
EHVAYMMFNVMKVSIAENDKEFNPEKYRNLSDVPPSFWAYPYMSAYYNYFFKEKMLRYDV
NTRVPYSAKEYEEKKKVRREEFAMAIIGARRLDYNEDGKVFVLDPYLEPSAMLNKYKDKD
ADKITDSFRYFVELALEKGLMKGDQFGYLNPQNPVTRGEAAAFIYNALNLDENNFVKPKR
GEKIPVPRITARKRNINVGILILPAPAWDSINNIPVNDPNPDFTLMELLNRNINKPMDWE
LVNPHPPAFDKSEYKDIMHLNSSKIPGIDNQSHSDFCAYFNDLRSVARAQTDLEADITYL
GTVGYSENINKSKFFKYWEVHLDDPNLTPEKIAKDYDLLFQTSHGKITYSKDVQDKVKAF
LKAGGQLWWENCKGLEIESGDGFTEEVKFVSLHPGHNRKYPQIPVLDDEGKMHPLFDNIF
RINPEKTSRVFAPGIYNKNSEISMLGDGEEWLNDDNRYLDELQPDDIVILNIENTDTGEI
LPNMAVRNIENEDAPDGRIVISTNDIGCGITKFVDRGGGKAVEDYKFCYNLLGWMSKIDV
SFDETTVNQWDGGSEFSVEATFTNNGAKKQIYDVTYEYDPKLWNLVPTSDFKNYKQTHPW
IKALDENGYPKKIELEPNQTEVVTYKFNIKRTNLRCYDFTIKASESGVKYTRDMAETLYR
LNNVRVEEPIFSGRRNNGSEASFDVTINAPEEPDSDLRTEDYELNIKIKKDGSFIDPETV
IDNIELLTDGNTPPLEGYNYKYLVDNKGVLYLKVIIEDTLITKPTEKIRLNISLKNLDSG
SYEVAGKIEVIDPVSRRRLAFSDEAIYKIK
Download sequence
Identical sequences A3DGQ1
WP_011838301.1.31213 gi|125974413|ref|YP_001038323.1| Cth-987 203119.Cthe_1911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]