SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125974464|ref|YP_001038374.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125974464|ref|YP_001038374.1|
Domain Number 1 Region: 516-835
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.08e-113
Family beta-glycanases 0.00000000000889
Further Details:      
 
Domain Number 2 Region: 43-274
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 3.57e-43
Family Carboxylesterase 0.00000000109
Further Details:      
 
Domain Number 3 Region: 293-419
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.52e-35
Family Family 6 carbohydrate binding module, CBM6 0.0000243
Further Details:      
 
Domain Number 4 Region: 428-492
Classification Level Classification E-value
Superfamily Type I dockerin domain 1.67e-16
Family Type I dockerin domain 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|125974464|ref|YP_001038374.1|
Sequence length 837
Comment glycoside hydrolase family protein [Clostridium thermocellum ATCC 27405]
Sequence
MSRKLFSVLLVGLMLMTSLLVTISSTSAASLPTMPPSGYDQVRNGVPRGQVVNISYFSTA
TNSTRPARVYLPPGYSKDKKYSVLYLLHGIGGSENDWFEGGGRANVIADNLIAEGKIKPL
IIVTPNTNAAGPGIADGYENFTKDLLNSLIPYIESNYSVYTDREHRAIAGLSMGGGQSFN
IGLTNLDKFAYIGPISAAPNTYPNERLFPDGGKAAREKLKLLFIACGTNDSLIGFGQRVH
EYCVANNINHVYWLIQGGGHDFNVWKPGLWNFLQMADEAGLTRDGNTPVPTPSPKPANTR
IEAEDYDGINSSSIEIIGVPPEGGRGIGYITSGDYLVYKSIDFGNGATSFKAKVANANTS
NIELRLNGPNGTLIGTLSVKSTGDWNTYEEQTCSISKVTGINDLYLVFKGPVNIDWFTFG
VESSSTGLGDLNGDGNINSSDLQALKRHLLGISPLTGEALLRADVNRSGKVDSTDYSVLK
RYILRIITEFPGQGDVQTPNPSVTPTQTPIPTISGNALRDYAEARGIKIGTCVNYPFYNN
SDPTYNSILQREFSMVVCENEMKFDALQPRQNVFDFSKGDQLLAFAERNGMQMRGHTLIW
HNQNPSWLTNGNWNRDSLLAVMKNHITTVMTHYKGKIVEWDVANECMDDSGNGLRSSIWR
NVIGQDYLDYAFRYAREADPDALLFYNDYNIEDLGPKSNAVFNMIKSMKERGVPIDGVGF
QCHFINGMSPEYLASIDQNIKRYAEIGVIVSFTEIDIRIPQSENPATAFQVQANNYKELM
KICLANPNCNTFVMWGFTDKYTWIPGTFPGYGNPLIYDSNYNPKPAYNAIKEALMGY
Download sequence
Identical sequences P10478
WP_003513959.1.16390 WP_003513959.1.31213 WP_003513959.1.60145 203119.Cthe_1963 gi|125974464|ref|YP_001038374.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]