SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125974530|ref|YP_001038440.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125974530|ref|YP_001038440.1|
Domain Number 1 Region: 186-461
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.95e-19
Family Pectate lyase-like 0.052
Further Details:      
 
Domain Number 2 Region: 739-806
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000000000131
Family Type I dockerin domain 0.00072
Further Details:      
 
Domain Number 3 Region: 581-736
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000425
Family CBM4/9 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|125974530|ref|YP_001038440.1|
Sequence length 807
Comment dockerin type I cellulosome protein [Clostridium thermocellum ATCC 27405]
Sequence
MKKAISLILTLLLIFNFLPLNFIIEAFAEDGGQLIIYPEYDERIPRCYDYSVTVHQGNQS
KTIPVYNRNANGEQMAYRCLSPDFNRRFCEFAFTGEVRVDITVYRDFETYSVLPSAKRYR
NEFHDGVISVWLNENDTKFMIRLDDDDDTILSVFADAPEDYDIDLNDESVLYVDEPWFDP
DENSAYYTLDEKIRTIYIAPGCVFYSRLIIKSNNVTICGHGILLDPFSDLHDASVTEDRT
NIYMDVNGNNFTIKDVKIIDSQGYHMYLLGTNHLIKNVKCLTARIRTDGVAVGAGNVTIT
NCFWYVSDNGFTYSGGYGYHRISNCIMGTTCAAFFPQHTLPYDVEFTDIYVFRADEGIIN
NWYNGAKIQSVVKNVTFNNLDCVDVINTPWIFSGKNMGDAVKNFYFNNCRFNAIRGSSIV
TEWNTKAGQAIHIINNDTLLHTSNYKLNFKNCYIDGKLITSESDFKPQYKDSNELTISIN
NDGTKPEYPLYCVRNKVNYTYNKKVYINHNLQKLQHQPIGDGSEILLPETEICNLLDIKI
NANTKGTTQNGIKYISLDEINRYYTKAVYDSEKSAVILSPVVDSSKNLLKDYSFACRYNP
YSNPGATLKPYVDNGEVVLRCIVTSNIYNQGLYTVVTDELEKYGAGVYTISFEARSYNGN
KTTVEVRPHYVRYEGYSLIEKNPKKSVTVNGQWQRYEVTFDISDWDLSVGASAIIRICSD
NTPGYDVLFKNIALTKVVPEVKKGDIVLDGNINSLDMMKLKKYLIRETQFNYDELLRADV
NSDGEVNSTDYAYLKRYILRIIDAFPQ
Download sequence
Identical sequences A3DH18
WP_020457693.1.31213 203119.Cthe_2038 gi|125974530|ref|YP_001038440.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]