SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125974609|ref|YP_001038519.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125974609|ref|YP_001038519.1|
Domain Number 1 Region: 407-707
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.88e-85
Family beta-glycanases 0.0000296
Further Details:      
 
Weak hits

Sequence:  gi|125974609|ref|YP_001038519.1|
Domain Number - Region: 707-749
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0051
Family Carboxypeptidase regulatory domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|125974609|ref|YP_001038519.1|
Sequence length 760
Comment glycoside hydrolase family protein [Clostridium thermocellum ATCC 27405]
Sequence
MIVGKVLDMDEKTAIIMTDDFAFLNVVRTSEMAVGKKVKVLDSDIIKPKNSLRRYLPVAA
VAACFVIVLSFVLMFINGNTARKNIYAYVGIDINPSIELWINYNNKIAEAKALNGDAETV
LEGLELKEKTVAEAVNEIVQKSMELGFISREKENIILISTACDLKAGEGSENKDVQNKIG
QLFDDVNKAVSDLKNSGITTRILNLTLEERESSKEENISMGRYAVYLKAKEQNVNLTIDE
IKDADLLELIAKVGIDNENVPEDIVTEDKDNLDAINTGPAESAVPEVTETLPATSTPGRT
EGNTATGSVDSTPALSKNETPGKTETPGRTFNTPAKSSLGQSSTPKPVSPVQTATATKGI
GTLTPRNSPTPVIPSTGIQWIDQANERINEIRKRNVQIKVVDSSNKPIENAYVEAVLTNH
AFGFGTAITRRAMYDSNYTKFIKDHFNWAVFENESKWYTNEPSMGIITYDDADYLYEFCR
SNGIKVRGHCIFWEAEEWQPAWVRSLDPFTLRFAVDNRLNSAVGHFKGKFEHWDVNNEMI
HGNFFKSRLGESIWPYMFNRAREIDPNAKYFVNNNITTLKEADDCVALVNWLRSQGVRVD
GVGVHGHFGDSVDRNLLKGILDKLSVLNLPIWITEYDSVTPDEYRRADNLENLYRTAFSH
PSVEGIVMWGFWERVHWRGRDASIVNDNWTLNEAGRRFESLMNEWTTRAYGSTDGSGSFG
FRGFYGTYRITVTVPGKGKYNYTLNLNRGSGTLQTTYRIP
Download sequence
Identical sequences A3DH97 H6SHY0
gi|125974609|ref|YP_001038519.1| gi|385780047|ref|YP_005689212.1| 203119.Cthe_2119 WP_003514230.1.19387 WP_003514230.1.20586 WP_003514230.1.31213 WP_003514230.1.55520 WP_003514230.1.60145 WP_003514230.1.6636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]