SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125974652|ref|YP_001038562.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125974652|ref|YP_001038562.1|
Domain Number 1 Region: 73-354
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 9.23e-53
Family Cellulases catalytic domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|125974652|ref|YP_001038562.1|
Sequence length 380
Comment glycoside hydrolase family protein [Clostridium thermocellum ATCC 27405]
Sequence
MKRFYLGLVVIVSFVLMLGGIIYSRRFGNGLLTDASGIFLDGDFQRNKYGEKKHILLKFI
KSRLMDSEGGITTNTHPSMGDSNTLSESTGILMECALINNDKNLFDMEYRYIKVNLVTEN
FFIKWKEGNDVFCNASIDDLRIIGALLEAYEKWGEKDYKNFALLLQKKIYDVQVKDGSLY
EFFDWKYNIPKTSTPLCYLNLKVIKKLQKYNKGWRKVYDRSLNIIKKGKIETSPLFYKYF
DYNLGRYSFDEEYQEKGGICLVYTLYTALSMAEAGIFDDELLNWLRNEMEKGKVYAWYNP
YSQKPVSDMESTAVYALGSIFAGLSGDEVLSQKLLDRMLEFMVTDENSQYYGGFGNSETG
EFYSFDNLMALKALALAEKP
Download sequence
Identical sequences A3DHE0
WP_003516866.1.16390 WP_003516866.1.19387 WP_003516866.1.20586 WP_003516866.1.31213 WP_003516866.1.55520 WP_003516866.1.6636 WP_003516866.1.6965 gi|385780092|ref|YP_005689257.1| 203119.Cthe_2167 gi|125974652|ref|YP_001038562.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]