SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125974664|ref|YP_001038574.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125974664|ref|YP_001038574.1|
Domain Number 1 Region: 39-362
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.19e-76
Family Pectate lyase-like 0.00053
Further Details:      
 
Domain Number 2 Region: 630-914
Classification Level Classification E-value
Superfamily Pectin lyase-like 8.69e-47
Family Pectate transeliminase 0.0001
Further Details:      
 
Domain Number 3 Region: 387-457
Classification Level Classification E-value
Superfamily Type I dockerin domain 5.49e-19
Family Type I dockerin domain 0.00029
Further Details:      
 
Domain Number 4 Region: 478-599
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000000000156
Family Family 6 carbohydrate binding module, CBM6 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|125974664|ref|YP_001038574.1|
Sequence length 922
Comment Pectate lyase/Amb allergen [Clostridium thermocellum ATCC 27405]
Sequence
MQKRVSAKISFLLVLSMFIGMFFVISRNSSVQAAPSFELVGFATLNGGTTGGTGGKEVTA
TSISQINELLSQRKKNKDTSPLVIKFDRKLTGSEVIACKKVSNITFLGVDGKGELEGAGI
NIVKSKNIIVRNLKIHHTRAPMDAIGIENSQNIWIDHCELYNEIGDCNGDGIVDPNDGDT
EGGDVDWYDGLLDIKKSSEYITVSWNYFHDSYKTSLIGSSDGDDYDRKITFHHNICANVK
SRTPSYRGGTGHMFNNYYVDVLGSGINSRVGAKLRIEGNIFERVGCGAVDSKTGFAEGPI
GSYYSSKIGYWDVRDNIFIDCKGNQPTTSTCSFEPPYKYDHVLQPASQVKETVLRYAGVQ
GNIVLPTTSPTNPPAATPTQPKNTQQPTVKYGDLNGDGNVNSTDSILMKRYLMKSVDLNE
EQLKAADVNLDGRVNSTDRSILNRYLLKIIEKLPYGNEIPPATPTPTDTHPSSTPTEGVV
HEAESSSNHLKYAKVESNYVVFDQTKDAYIEMKKVNSPVTGEVTITIVYSNGSGKSLPME
IKVNSTTIESNKEFPSTGAWNIWSTLSVKANMNSGSDNVIRIKTRSNDGGPRIDKVIVSA
GGSGYTPATTPPSTTKPVTTPTPTVPTSTSAIPVEGDIILSPNGSMTLQQAIDLIQPGKT
IYLKAGTYKYSKTILIKEGNDGLPNARKTLAAYGDGEVIIDFSAMTENSSNRGIVLDAKY
WHVKGITIKGAGDNGMLLSGHYNIIEKCTFRENRDSGLQLSRYNTSYNTKDKWPSNNLII
DCLSTMNMDSRREDADGFAAKLTCGEGNVFRNCIAINNCDDGWDLYTKKETGAIGVVTLE
NCQAIGNGYGVNGKDTGGDGNGYKLGDDTASVPHILINCVAKNNKKHGFTGNGNPAKIVL
QNCTGSGNGGKLFDRLDNAIFK
Download sequence
Identical sequences A3DHF2
gi|125974664|ref|YP_001038574.1| 203119.Cthe_2179 WP_020457732.1.31213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]