SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125974676|ref|YP_001038586.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125974676|ref|YP_001038586.1|
Domain Number 1 Region: 182-621
Classification Level Classification E-value
Superfamily (Trans)glycosidases 9.6e-118
Family Amylase, catalytic domain 0.00000000238
Further Details:      
 
Domain Number 2 Region: 629-731
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 4.39e-35
Family alpha-Amylases, C-terminal beta-sheet domain 0.00023
Further Details:      
 
Domain Number 3 Region: 14-116
Classification Level Classification E-value
Superfamily E set domains 2.1e-19
Family E-set domains of sugar-utilizing enzymes 0.0097
Further Details:      
 
Domain Number 4 Region: 140-199
Classification Level Classification E-value
Superfamily E set domains 0.00000000476
Family E-set domains of sugar-utilizing enzymes 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|125974676|ref|YP_001038586.1|
Sequence length 737
Comment 1,4-alpha-glucan branching protein [Clostridium thermocellum ATCC 27405]
Sequence
MNTTANIDEVYKVINAEHHDPFSVLGMHRLESENAMVVRAYLPNAKEIEVVELSKNNTYP
MEKIDERGFFEVVIKDRNDFFKYNLRATDYVGNTFTFYDPYCFMPVISDYDLYLFNEGNH
HKIYEKLGTHRMTIDGVEGTLFAVWAPCAKRVSVVGNFNQWDGRRHQMRVRGSSGVWELF
IPGVGEGELYKYEIKTPHNEIYIKADPYAFYSELRPNTASIVYDIEGYEWHDADWMRERD
SSNSFDKPISIYEVHLGSWKRVSNDENGFYSYRELADMLVEYVKYMGYTHIELLPIAEHP
FDGSWGYQVTGYYAATSRYGQPKDFMYFVDKCHQNGIGVIIDWVPAHFPKDGHGLARFDG
TALYEHYDPKQGEHPDWGTHIFNYGRNEVKNFLIANAMFWFDKYHIDGLRVDAVASMLYL
DYGKKDGEWIPNRWGGKENVDAIEFMRQLNSTVFQYFPGVMMIAEESTAWALVTKPPYTG
GLGFSYKWNMGWMNDFLRYMSMDSVYRKYHQNLITFSLMYAFSENFILVLSHDEVVHGKC
SMINKMPGDYWQKFAGLRASYGYLYGHPGKKLLFMGGEFAQFIEWNYKQSLDWFLLDYDM
HKKMQDYVRDLNKLYRSEKALYEVDFHYDGFEWIDCNDTEHSIISFMRKGKDWHNSLIFV
CNFTPVPHEDYRIGSPFNTTYDEIFNSDWEKYGGSNVGNFEPIKAEEISMHNKPYSMRLR
IPPLATIVLKPRFDRKD
Download sequence
Identical sequences A3DHG4
203119.Cthe_2191 gi|125974676|ref|YP_001038586.1| gi|385780120|ref|YP_005689285.1| WP_003513674.1.19387 WP_003513674.1.20586 WP_003513674.1.31213 WP_003513674.1.55520 WP_003513674.1.60145 WP_003513674.1.6636 WP_003513674.1.6965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]