SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125974679|ref|YP_001038589.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125974679|ref|YP_001038589.1|
Domain Number 1 Region: 293-424
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.4e-43
Family Family 6 carbohydrate binding module, CBM6 0.00023
Further Details:      
 
Domain Number 2 Region: 46-274
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.09e-41
Family Carboxylesterase 0.00000000424
Further Details:      
 
Domain Number 3 Region: 438-500
Classification Level Classification E-value
Superfamily Type I dockerin domain 2.06e-16
Family Type I dockerin domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|125974679|ref|YP_001038589.1|
Sequence length 501
Comment carbohydrate-binding family 6 protein [Clostridium thermocellum ATCC 27405]
Sequence
MLRKVLSVLLICLVLIACLGTAVNISSAASLPTMPPSGYDQVRGGIQRGQVVNISYYSTA
TNGTRPAKVYLPPGYSTSKRYSVLYLLHGIGGSEGDWFADWGGRASIIADNLIAEGKIKP
LIIVTPNTNAAGPGIGDGYENFTKDLINCLIPYIESRYSVYTDREHRAIAGLSMGGGQSF
NIGLTNLDKFAYIGPISSAPNTYPNNRLFPDGGAAARQKLKLLFIACGTNDSLIGFGQRV
HEFCVANNINHIYWLIQGGGHDYNVWKAGLWNFLQLAEQAGLTDYNAPTPPPPAPRSAFT
RIEAEDFDNMSGIENESCSEGGLNIGYIENGDYVAYSNIDFGNGAKEFQARVASATSGGK
IEIRLDSITGPLIGTCSVSGTGGWQQWVDVKCEVSGVSGTHDLYLKFTGGSGYLFNINWW
KFTQADSNPTPTPPPNENLGDLNGDGNINSTDLQILKKHLLRITLLTGKELSNADVTKDG
KVDSTDLTLLKRYILRFVTNF
Download sequence
Identical sequences A3DHG7
WP_020457735.1.31213 gi|125974679|ref|YP_001038589.1| 203119.Cthe_2194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]