SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125974680|ref|YP_001038590.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125974680|ref|YP_001038590.1|
Domain Number 1 Region: 767-895
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.95e-39
Family Family 6 carbohydrate binding module, CBM6 0.00012
Further Details:      
 
Domain Number 2 Region: 31-135,256-279,312-564
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.88e-32
Family Pectate transeliminase 0.016
Further Details:      
 
Domain Number 3 Region: 903-964
Classification Level Classification E-value
Superfamily Type I dockerin domain 6.28e-16
Family Type I dockerin domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|125974680|ref|YP_001038590.1|
Sequence length 965
Comment carbohydrate-binding family 6 protein [Clostridium thermocellum ATCC 27405]
Sequence
MVNGIIGIMTKRHMIVIMALLFTVSVLSAGLLFINTVNAAEPITYYVSPTGSDSNTGTID
APFKTIAKARDVVRTVNGNMKSDIYVYLRGGTYNITETITFGPQDSGTNGYRIYYMAYPG
ETPVLSGATKVTGWTRHNGNIYKAKLNRSTKLRNLYVNDQRASMTSKRVTARGGHGTYTV
TAGQAPWAWTSGSKSDGVRYDMSEVPEITRNKDDLEIVNGTTWNENIVCTRDVITANGYR
VLLLQQPYGAIAQTPGWGAAFTTSGTHTIYNAFEFLNSPGQFYFDKTEQMLYYYLRPGEN
IETIDVQAPMVEKLIEIAGTSTSNRVKNITFQGITFAYTDYNLVEVGGSRGKSTCQAAQG
FIAFFNDNWHYTKYDLVDTLPGMINLRNCDSIDFIENVIKHSGADGISMVNDVINCKIIG
NYITDITSSGITVGHPQHVYIGDGGSRAKFPSGVEGVCKNNTISNNVLYDISMVPGFGGC
AGITAYFVEGLEITHNHVQKTAYNGIHLGWGWCNFKDSTTCKNNTISYNRVVDTLSRLHD
SGAIYTIGQMPGTNINENYVKGIPPATYGPTYGLHNDEGTAYIIENDNVLNIDPGVKYTI
NCEDFGEKHDLTILRTYATVSKMGKNPPNSRIDPPVAVPDNVWPLRQYNVCLNSGIQDEY
RKIMPESLLSTPDYVFPASCAAEAASIINIRSSGDPSNTVWFAPPGTTTFVEGATMTKAA
GDATSIIAPYTAGTYKLYIVNSQGVKIGESESILRVSGSVNPPPKEPRSAFTRIEAESYN
GQSGIQTENCSEGGMDVGYIENGDYVVYKNIDFGKGAASFKARVASATSGGNIELRIDSI
DGPVVGICPVAGSGGWQQWVDATCEVSGLKGVHDLYLKFTGGSGYLLNINWFTFVEGNND
ENLGDLNDDGKVNSTDFQILKKHLLRITLLTGKNLSNADLNKDGKVDSSDLSLMKRYLLQ
IIPTF
Download sequence
Identical sequences A3DHG8
gi|125974680|ref|YP_001038590.1| 203119.Cthe_2195 WP_020457736.1.31213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]