SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125974756|ref|YP_001038666.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125974756|ref|YP_001038666.1|
Domain Number 1 Region: 106-175
Classification Level Classification E-value
Superfamily Type I dockerin domain 3.04e-16
Family Type I dockerin domain 0.002
Further Details:      
 
Domain Number 2 Region: 34-103
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000000000144
Family Type I dockerin domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|125974756|ref|YP_001038666.1|
Sequence length 178
Comment dockerin type I cellulosome protein [Clostridium thermocellum ATCC 27405]
Sequence
MKKKIALLTVVLIVAMVVLGGSMTAYAGHQCSVTVIIGDVNLDGSVDSIDLALLYNTTYY
AVPLPNRLQYIAADVNYDSSCTMLDFYMLEDYLLGRISSFPAGQTYTVYYGDLNGDQLVT
TTDQSLLSDYLLGRINLTFRQYVSADVNGDGTVDGIDLAIITAYINGQIQHFPVCPQS
Download sequence
Identical sequences A3DHP4
WP_003513507.1.19387 WP_003513507.1.20586 WP_003513507.1.31213 WP_003513507.1.55520 WP_003513507.1.60145 WP_003513507.1.6636 WP_003513507.1.6965 Cth-1559 gi|385780210|ref|YP_005689375.1| gi|125974756|ref|YP_001038666.1| 203119.Cthe_2271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]