SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125974845|ref|YP_001038755.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125974845|ref|YP_001038755.1|
Domain Number 1 Region: 17-55,87-504
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 4.86e-130
Family Cellulases catalytic domain 0.0000000381
Further Details:      
 
Domain Number 2 Region: 702-852
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 4.13e-48
Family Cellulose-binding domain family III 0.00011
Further Details:      
 
Domain Number 3 Region: 524-679
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 1.88e-40
Family Cellulose-binding domain family III 0.00012
Further Details:      
 
Domain Number 4 Region: 860-927
Classification Level Classification E-value
Superfamily Type I dockerin domain 3.24e-18
Family Type I dockerin domain 0.00027
Further Details:      
 
Weak hits

Sequence:  gi|125974845|ref|YP_001038755.1|
Domain Number - Region: 49-94
Classification Level Classification E-value
Superfamily EF-hand 0.00271
Family Calmodulin-like 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|125974845|ref|YP_001038755.1|
Sequence length 928
Comment glycoside hydrolase family protein [Clostridium thermocellum ATCC 27405]
Sequence
MITSIIAVPSYVSAEPEYNFAKALQLSLYFYDANKCGEGITGGRLEWRGDCHLEDKEVPL
IPMTEDYFGTNMSQEYIDKYRHIFDPDGDGTVDLSGGMHDAGDHVKFGLPGTYAASTLGW
GFYEFREAYEKVGVDDHAKEILRWFNDFYLKATFLDEDGNVIAYCYQVGEGNIDHNFWNP
PELQSSKVLDSFARPAYFATPETPASDQCAGAAASLAINYLNFKDEDPEYAQRCLDTAIA
LYEFAKKYRGLGESGGFYGSSYDHDELAWAAVWLNIATGDMQYIDDIVATDSEGNYIGYM
QRIIKDTTNTWQNIWVHCWDTVWGGVFAKLAPITNTERDWYIFRWNLEYWSGIPHENPND
TTFLAKSPGGFSVVNAYGSARYNTAAQLCALVYRKYTGRSDFADWAKSQMEYIMGNNPMN
RCYIVGYSENSAKHPHHRAAHGSKTFSMLDPEEHRHTLWGALVGGPDLDDFHVDETTDYV
YNEVAVDYNAAFVGACAGLYYYYGEALGHKPVPNFPPKEEAVEEYYVEGKIEQENKERTQ
VTIKIFNDTCHPPRFETGLMARYFFNISELLDAGQSIDDVKIEVYYDENKASYDGPAEVR
GPIKYDDAGTYYVEVDWSGRIIYGKREIQLALISSLDSNYKSNWNPENDYSREGLGKEFV
RTEKIPLYLNGVKVFGNEPPQIEPSPTPSDGPGSTPPPSQKPSLEVLYKYGDTTAATKDI
RGSIKIKNTGTKPVNLSDVKVRYWFTKDGASSQEFVCDYAHLSESMITAKFVDLENPVEN
ADNYLEIGFDSNAGILGPGSDTGEIQFRIVKGDYESYDQSNDYSCMATAKDFTANPNITA
YVNSVLVYGNPPVDEEEEIEIVYGDLNGDGRVNSTDLLLMKKRIIREIDKFNVPDENADL
NLDGKINSSDYTILKRYVLKSIEKLPVK
Download sequence
Identical sequences A3DHY3
gi|125974845|ref|YP_001038755.1| 203119.Cthe_2360 WP_020457778.1.31213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]