SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125975032|ref|YP_001038942.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125975032|ref|YP_001038942.1|
Domain Number 1 Region: 17-385
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.6e-122
Family beta-glycanases 0.000000000000645
Further Details:      
 
Domain Number 2 Region: 373-502
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 5.04e-41
Family Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 0.000000892
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|125975032|ref|YP_001038942.1|
Sequence length 503
Comment alpha-N-arabinofuranosidase [Clostridium thermocellum ATCC 27405]
Sequence
MKKARMTVDKDYKIAEIDKRIYGSFVEHLGRAVYDGLYQPGNSKSDEDGFRKDVIELVKE
LNVPIIRYPGGNFVSNYFWEDGVGPVEDRPRRLDLAWKSIEPNQVGINEFAKWCKKVNAE
IMMAVNLGTRGISDACNLLEYCNHPGGSKYSDMRIKHGVKEPHNIKVWCLGNEMDGPWQV
GHKTMDEYGRIAEETARAMKMIDPSIELVACGSSSKDMPTFPQWEATVLDYAYDYVDYIS
LHQYYGNKENDTADFLAKSDDLDDFIRSVIATCDYIKAKKRSKKDIYLSFDEWNVWYHSN
NEDANIMQNEPWRIAPPLLEDIYTFEDALLVGLMLITLMKHADRIKIACLAQLINVIAPI
VTERNGGAAWRQTIFYPFMHASKYGRGIVLQPVINSPLHDTSKHEDVTDIESVAIYNEEK
EEVTIFAVNRNIHEDIVLVSDVRGMKDYRLLEHIVLEHQDLKIRNSVNGEEVYPKNSDKS
SFDDGILTSMLRRASWNVIRIGK
Download sequence
Identical sequences A3DIH0
203119.Cthe_2548 WP_003513072.1.16390 WP_003513072.1.19387 WP_003513072.1.20586 WP_003513072.1.31213 WP_003513072.1.55520 WP_003513072.1.60145 WP_003513072.1.6636 WP_003513072.1.6965 gi|385777515|ref|YP_005686680.1| gi|125975032|ref|YP_001038942.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]