SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125975033|ref|YP_001038943.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125975033|ref|YP_001038943.1|
Domain Number 1 Region: 252-323
Classification Level Classification E-value
Superfamily Type I dockerin domain 9.71e-19
Family Type I dockerin domain 0.0007
Further Details:      
 
Domain Number 2 Region: 15-66,114-244
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.00000000137
Family Serum paraoxonase/arylesterase 1, PON1 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|125975033|ref|YP_001038943.1|
Sequence length 324
Comment dockerin type I cellulosome protein [Clostridium thermocellum ATCC 27405]
Sequence
MAYLDNELFVTALTDSQSLYWLPEGPNGMIAVIDTKTVELKEKIDIKIRPFNIFAGKNGY
LYVTSREPQKAYFNSYSRSTKEFMDSELVNNECLSEYNPTLDRIYAIPIDIMPIDYKVLN
VDNGKFVSSYSSTYYDSYPLAEKFKISPDGKYLFNSSGVVFTCNENVNEDMKFAFTLDKK
FTDIAFNMEENRFYTAVGGNQIYVYNYEDFSGIDTLSSTGEILKLFYVDGKLCALSRSAN
GRPMFEVIQKVKIKYGDVNKDGRINSTDIMYLKGYLLRNSAFNLDEYGLMAADVDGNGSV
SSLDLTYLKRYILRRISDFPANKK
Download sequence
Identical sequences A3DIH1
gi|125975033|ref|YP_001038943.1| WP_003518346.1.16390 WP_003518346.1.19387 WP_003518346.1.20586 WP_003518346.1.31213 WP_003518346.1.55520 WP_003518346.1.6636 WP_003518346.1.6965 203119.Cthe_2549 gi|385777517|ref|YP_005686682.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]