SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125975073|ref|YP_001038983.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125975073|ref|YP_001038983.1|
Domain Number 1 Region: 209-511
Classification Level Classification E-value
Superfamily (Trans)glycosidases 7.65e-96
Family beta-glycanases 0.0000215
Further Details:      
 
Domain Number 2 Region: 30-178
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.83e-44
Family CBM22 0.0068
Further Details:      
 
Domain Number 3 Region: 571-638
Classification Level Classification E-value
Superfamily Type I dockerin domain 4.51e-18
Family Type I dockerin domain 0.00018
Further Details:      
 
Domain Number 4 Region: 507-564
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00000251
Family Carboxypeptidase regulatory domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|125975073|ref|YP_001038983.1|
Sequence length 639
Comment glycoside hydrolase family protein [Clostridium thermocellum ATCC 27405]
Sequence
MKKTASFILVLSLLLAFIIPAEGGLAAEGNLLFNPGFELGSTEGWYPYGECTIEAVGTEA
HSGNYSVFVTDRTQDWNGVAQDMLDKLTVGMTYQVSAWVKVAGTGSHQVKISMKKVETGK
EPVYDNIASITVEGSEWYRLSGPYSYTGTNVTNLELYIEGPQPGVSYYVDDVTVTEVGSA
ATWKEEANARIEQIRKRDAKIRIVDSNNKPVSGVSIDVRQVKHEFGFGSAITMNGIHDPR
YTEFFKNNYEWAVFENEAKWYSNESSQGNVSYANADYLYNWCAENGIKVRGHCIFWEPEE
WQPSWLKGLTGDALMKAIDARLESVVPHFRGKFLHWDVNNEMLHGDFFKSRLGESIWPYM
FKRARELDPDAKLFVNDYNIITYVEGDAYIRQIEWLLQNGAEIDGIGVQGHFDEDVEPLV
VKARLDNLATLGIPIWVTEYDSKTPDVNKRAENLENLYRIAFSHPAVEGIIMWGFWAGNH
WRGQDAAIVDHDWTVNEAGKRYQALLKEWTTITSGTTDSTGAFDFRGFHGTYEITVSVPG
KEPFVKTIELTKGNGTAVYTFTVDGTDAGNVLYGDLNQDGQVSSTDLVAMKRYLLKNFEL
SGVGLEAADLNSDGKVNSTDLVALKRFLLKEIDELPLKR
Download sequence
Identical sequences A3DIL1
gi|385777558|ref|YP_005686723.1| 203119.Cthe_2590 gi|125975073|ref|YP_001038983.1| WP_003512991.1.16390 WP_003512991.1.19387 WP_003512991.1.20586 WP_003512991.1.31213 WP_003512991.1.55520 WP_003512991.1.60145 WP_003512991.1.6636 WP_003512991.1.6965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]