SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125975201|ref|YP_001039111.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125975201|ref|YP_001039111.1|
Domain Number 1 Region: 10-113
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 7.46e-41
Family N-utilization substance G protein NusG, N-terminal domain 0.0000508
Further Details:      
 
Domain Number 2 Region: 122-177
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 1.12e-18
Family N-utilization substance G protein NusG, C-terminal domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|125975201|ref|YP_001039111.1|
Sequence length 177
Comment transcription antitermination protein nusG [Clostridium thermocellum ATCC 27405]
Sequence
MPNNEASEEAKWYVVHTYSGYENKVKANLEKIVENRNLQDYILDIVVPMEEQIEIKDGKK
KASLKKVFPGYVLVKMIMNDESWYVVRNTRGVTGFVGPGSKAVPLTDEEIRAMGVEEFAP
VLDYEVGDNVRVVSGPLENFIGIVEEINLEKKKVRVSVSMFGRETPVELELHQIQKI
Download sequence
Identical sequences A3DIY9
gi|385777685|ref|YP_005686850.1| gi|125975201|ref|YP_001039111.1| 203119.Cthe_2719 2005285268 Cth-56 WP_003515022.1.16390 WP_003515022.1.19387 WP_003515022.1.20586 WP_003515022.1.31213 WP_003515022.1.55520 WP_003515022.1.60145 WP_003515022.1.6636 WP_003515022.1.6965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]