SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125975287|ref|YP_001039197.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125975287|ref|YP_001039197.1|
Domain Number 1 Region: 39-193
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000411
Family Family 27 carbohydrate binding module, CBM27 0.087
Further Details:      
 
Weak hits

Sequence:  gi|125975287|ref|YP_001039197.1|
Domain Number - Region: 224-401
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.000108
Family Matrix metalloproteases, catalytic domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|125975287|ref|YP_001039197.1|
Sequence length 460
Comment carbohydrate-binding, CenC-like protein [Clostridium thermocellum ATCC 27405]
Sequence
MDFTASTTSVDIAVRLGYTNSKVTGTAWFDNITVEHLPKTVFTEDFENGLSSNWEIRSSK
HGNSLATVTVESGTGVNNSKCLKISSLAQDEDVGCVKTLQLAPNSYYKLSALMKYENVTP
GKSDGANICLYNNEGEDAIWIRTATATGTNTSWELVKLLFKTPDSGSVNIGLRLGFLNCE
TKGTVWFDNVKVEAVPSDYIYESEHIIACFETDDTQFATREGILNWLSELDKVYVLMKEF
SGNRVPFDGKKMGILSSDSHSGGVGAYAGDPIMWFKSANDNPVAYQLKMTCEHGDLSFAI
LHEIGHNFNLGNTSWNWNDEMFANFRAYYAVEQLENLHLNNMGPMPVVYNYPNIRREGTE
LKDYYSERYNETMAQGEFHHDGLMYTLILAKEKIGWEPFLKTIQYLSSNDFSNKNDMEKF
ELFYSKLSEYSQQPISELISDEDMSLVRAYWNEHGSLFTR
Download sequence
Identical sequences A3DJ75
gi|125975287|ref|YP_001039197.1| 203119.Cthe_2805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]