SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125975294|ref|YP_001039204.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125975294|ref|YP_001039204.1|
Domain Number 1 Region: 39-513
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 3.37e-146
Family Cellulases catalytic domain 0.013
Further Details:      
 
Domain Number 2 Region: 544-610
Classification Level Classification E-value
Superfamily Type I dockerin domain 2.25e-18
Family Type I dockerin domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|125975294|ref|YP_001039204.1|
Sequence length 611
Comment glycoside hydrolase family protein [Clostridium thermocellum ATCC 27405]
Sequence
MRKNLFAKRAVAFLLGIVITAAGIVSFNTVSTSAAGEYNYAKALQYSMFFYDANMCGTGV
DENSLLSWRGDCHVYDARLPLDSQNTNMSDGFISSNRSVLDPDGDGKVDVSGGFHDAGDH
VKFGLPEAYAASTVGWGYYEFKDQFRATGQAVHAEVILRYFNDYFMRCTFRDASGNVVAF
CHQVGDGDIDHAFWGAPENDTMFRRGWFITKEKPGTDIISATAASLAINYMNFKDTDPQY
AAKSLDYAKALFDFAEKNPKGVVQGEDGPKGYYGSSKWQDDYCWAAAWLYLATQNEHYLD
EAFKYYDYYAPPGWIHCWNDVWSGTACILAEINDLYDKDSQNFEDRYKRASNKNQWEQID
FWKPIQDLLDKWSGGGITVTPGGYVFLNQWGSARYNTAAQLIALVYDKHHGDTPSKYANW
ARSQMDYLLGKNPLNRCYVVGYSSNSVKYPHHRAASGLKDANDSSPHKYVLYGALVGGPD
ASDQHVDRTNDYIYNEVAIDYNAAFVGACAGLYRFFGDSSMQIDPSMPSHNVPVPPTPTP
PDTQIVYGDLNGDQKVTSTDYTMLKRYLMKSIDRFNTSEQAADLNRDGKINSTDLTILKR
YLLYSIPSLPI
Download sequence
Identical sequences A3DJ82 Q8VV73
2yik_A 203119.Cthe_2812 gi|125975294|ref|YP_001039204.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]