SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125975360|ref|YP_001039270.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125975360|ref|YP_001039270.1|
Domain Number 1 Region: 97-135,241-372
Classification Level Classification E-value
Superfamily SGNH hydrolase 5.5e-19
Family Putative acetylxylan esterase-like 0.047
Further Details:      
 
Domain Number 2 Region: 35-101
Classification Level Classification E-value
Superfamily Type I dockerin domain 4.32e-18
Family Type I dockerin domain 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|125975360|ref|YP_001039270.1|
Sequence length 511
Comment dockerin type I cellulosome protein [Clostridium thermocellum ATCC 27405]
Sequence
MKASKVGQKVILFLVSFSLFISCITISATAANGGKLGDINSDGSINSTDVTLLKRHLLRE
NILTGTAYSNADTDGDGKITSIDLSYLKRYVLRLISSFPGETSNNLNIPWDWVGIIGTGQ
SLSVGTTPILSTTQPYNNLKLDLGNLRVPPYDANSSELKLVPLTEPIRSLATGFPSAYPR
NLYGETPHSAMANQITAMVKAAGRNDYISVHTVVGESGQGMSVIKKGATDTGNTGRAYAA
SIFEVTAINRLAKAAGKTYGVGGIILTHGETDCGNPNYENELRQLWSDYNKDIKAITGQT
QNIPMFVVQQHSYPSTGTSASTLAQWKAGVDYPGDIICIGPNYQRTYGGDNVHLTSAGYQ
HLGEKYAQVYYEKVILGKDWKPLQPIKATKNGRTIIVDFHVPVPPLVWDNTLPAPNQNTL
TEWRNGKGFEVTANGSRVTINSVEISGNSVIITCASELPAWGVKVGYAFTGGKARPNGTY
RWGLLRDSDPFIGRSGVAQPNFCVSFEMPVN
Download sequence
Identical sequences A3DJE8
203119.Cthe_2879 WP_020457956.1.31213 gi|125975360|ref|YP_001039270.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]