SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125975431|ref|YP_001039341.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125975431|ref|YP_001039341.1|
Domain Number 1 Region: 49-334
Classification Level Classification E-value
Superfamily Pectin lyase-like 3.34e-65
Family Pectate lyase-like 0.00027
Further Details:      
 
Domain Number 2 Region: 429-551
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.91e-26
Family Family 6 carbohydrate binding module, CBM6 0.011
Further Details:      
 
Domain Number 3 Region: 356-425
Classification Level Classification E-value
Superfamily Type I dockerin domain 5.98e-19
Family Type I dockerin domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|125975431|ref|YP_001039341.1|
Sequence length 554
Comment Pectate lyase/Amb allergen [Clostridium thermocellum ATCC 27405]
Sequence
MSRCWVKCISSMLAISLILFASLTLTASLIVASFLPATTTYAQTVSPLDRPIGWASEAGG
TTGGGNAAPVIVTSASELQNLVKDNTPRVIYVQGNIGGNYTVGSNKTIIGLPGATTGSWT
FKGSSNVILRNLKIRGNGADGDAVTVTDYSHHIWFDHLDLADSTDENLSIKRGSDYITIS
WCKYWFSRDGGHTFGGLIGHSDNNAAQDEGRLRVTYHHNWYSKGVTERMPRVRFGKVHIF
NNLFDAPGNNYVIRCGYKANIRSEGNVFVNMKNCFDFSTSSPDSVLQSINDLFIGNCSGT
TGRGIAFVPPYQYTVEPTAGLKEKIEAGAGATLNVPGTFSPTPSPSNTPTATPTPASIVY
GDLNNDGRTNSTDYSLMKRYLLGSISFTNEQLKAADVNLDGKVNSSDYTVLRRFLLGSID
LLPYNGTATYQAEDAVFSGAIFETKNAGYTGTGYVNYDNVPGGYIEWTLNIANAGTYTLT
LTYANGTSSNRTVDISVNGNIVASGVVFGGTGSWTQWQTKSITASLNSGVNKIRVTGTSS
DGGPNIDKLEIRRN
Download sequence
Identical sequences A3DJL9
gi|125975431|ref|YP_001039341.1| WP_003514714.1.16390 WP_003514714.1.31213 WP_003514714.1.60145 203119.Cthe_2950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]