SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125975452|ref|YP_001039362.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125975452|ref|YP_001039362.1|
Domain Number 1 Region: 31-232
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.49e-86
Family Xylanase/endoglucanase 11/12 0.0000000491
Further Details:      
 
Domain Number 2 Region: 480-665
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 4.94e-54
Family NodB-like polysaccharide deacetylase 0.0000000147
Further Details:      
 
Domain Number 3 Region: 245-374
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.76e-36
Family Family 6 carbohydrate binding module, CBM6 0.00000119
Further Details:      
 
Domain Number 4 Region: 391-457
Classification Level Classification E-value
Superfamily Type I dockerin domain 4.45e-19
Family Type I dockerin domain 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|125975452|ref|YP_001039362.1|
Sequence length 683
Comment glycoside hydrolase family protein [Clostridium thermocellum ATCC 27405]
Sequence
MKQKLLVTFLILITFTVSLTLFPVNVRADVVITSNQTGTHGGYNFEYWKDTGNGTMVLKD
GGAFSCEWSNINNILFRKGFKYDETKTHDQLGYITVTYSCNYQPNGNSYLGVYGWTSNPL
VEYYIIESWGTWRPPGATPKGTITVDGGTYEIYETTRVNQPSIKGTATFQQYWSVRTSKR
TSGTISVTEHFKAWERLGMKMGKMYEVALVVEGYQSSGKADVTSMTITVGNAPSTSSPPG
PTPEPTPRSAFSKIEAEEYNSLKSSTIQTIGTSDGGSGIGYIESGDYLVFNKINFGNGAN
SFKARVASGADTPTNIQLRLGSPTGTLIGTLTVASTGGWNNYEEKSCSITNTTGQHDLYL
VFSGPVNIDYFIFDSNGVNPTPTSQPQQGQVLGDLNGDKQVNSTDYTALKRHLLNITRLS
GTALANADLNGDGKVDSTDLMILHRYLLGIISSFPRSNPQPSSNPQPSSNPQPTINPNAK
LVALTFDDGPDNVLTARVLDKLDKYNVKATFMVVGQRVNDSTAAIIRRMVNSGHEIGNHS
WSYSGMANMSPDQIRKSIADTNAVIQKYAGTTPKFFRPPNLETSPTLFNNVDLVFVGGLT
ANDWIPSTTAEQRAAAVINGVRDGTIILLHDVQPEPHPTPEALDIIIPTLKSRGYEFVTL
TELFTLKGVPIDPSVKRMYNSVP
Download sequence
Identical sequences A3DJP0
WP_020457977.1.31213 203119.Cthe_2972 gi|125975452|ref|YP_001039362.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]