SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125975468|ref|YP_001039378.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125975468|ref|YP_001039378.1|
Domain Number 1 Region: 427-628,660-982
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 2.1e-52
Family Glycosyltransferase family 36 C-terminal domain 0.00025
Further Details:      
 
Domain Number 2 Region: 200-405
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.0000119
Family Glycosyltransferase family 36 N-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|125975468|ref|YP_001039378.1|
Sequence length 984
Comment glycosyltransferase [Clostridium thermocellum ATCC 27405]
Sequence
MITKVTARNNKITPVELLNQKFGNKINLGNFADAVFTDAAFKNVAGIANLPMKAPVMQVL
MENCIVSKYLKQFVPDRSVCFVEEGQKFYIVLEDGQKIEVPEDVNKALRATVSDVKHWAG
YLTEDGEHVIDLLKPAPGPHFYVNLLIGNRLGFKRTLQTTPKSVVDRFGRGSFRSHAATQ
VLATRFDMRQEENGFPANRQFYLYEDGKQIFYSALIDDNIVEATCKHSCNRTVIKYKTAC
NLEITRTIFLVPHKKGFPLATELQRIEIKNASDKARNLSITYTGMFGTGAVHAIFEDVTY
TNVIMQSAALYNDKGEFIGITPDYYPEEFKQDTRFVTMIVRNGDEKSFPQSFCTDYNDFV
GTGTLEHPAGGCNLNNKLNRKGPGFFALGAPFTVEPGKTVIIDTFTGLSSSKDNENYSDA
VMLRELDNLLRYFEKSESVEETLNEIINFHENYGKYFQFNTGNKLFDSGFNRNLAFQVLY
QTFMSRSFGQTQKGYREIGFREIQDLFASMYYFINIGYQDFVKELLFEWTANVYKMGYAN
HNFYWVGKQPGLYSDDSLWLLQAYYRYIIYTKDTSVLNEEVPVADGNNEKRAVRETLKAI
IQYSACISVGDHGLPLLDLADWNDCLKIDSNSIDGATKEKLYYEQLKKTNGKYGDRFMSD
YSESVMNAFLLKLAIDHLAEIATLDNDTQLAQQMSELSKEVTDRIQKHAWKENFFARVLI
NRYKDGSYTYLGAKGDKLSADPNIDGVYFLNSFAWSVLSDVATDEQIAIMVDVIKKYLLT
PYGLRLVTPADLNKIANDTATGHYFFGDRENGAVFKHASMMAVVALIKAAKKVKDNELAK
EMARIAYFMIDLVLPYKNLENPFQVAGNPRICTQYINTDTGENIGPLLSGTATWLNLNLI
SLAGIEYTRDGISFNPILREEETQLNFTLKAPKCSYKFSITKPVGFARMESSEYELFVDG
QKIDNTVIPMYTDEKEHIVTLKFK
Download sequence
Identical sequences A3DJQ6
WP_020457986.1.31213 203119.Cthe_2989 gi|125975468|ref|YP_001039378.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]