SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125975529|ref|YP_001039439.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125975529|ref|YP_001039439.1|
Domain Number 1 Region: 165-329
Classification Level Classification E-value
Superfamily Fibronectin type III 1.24e-20
Family Fibronectin type III 0.0005
Further Details:      
 
Domain Number 2 Region: 332-417
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000011
Family Fibronectin type III 0.0033
Further Details:      
 
Weak hits

Sequence:  gi|125975529|ref|YP_001039439.1|
Domain Number - Region: 358-641
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0879
Family Filamentous hemagglutinin FhaB, secretion domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|125975529|ref|YP_001039439.1|
Sequence length 667
Comment fibronectin, type III [Clostridium thermocellum ATCC 27405]
Sequence
MNKWEIIKKTVSVCLLLSITFSIFINSDVVLALSQKVENINFGENINFYGVVQDSAIRLV
TPTVGVEPTPIGSLTPAVTETPLATPTQETLPSPSPSEFSTPTPSFTPDASPESTSTPFP
SPLPFPMPDSTSTPTPDPDSTSTPTPTPTPIPTPSVSPSPSDTEAPSRPECLVTTDRTDT
MISLSWSASTDNVGVKGYYIYRDGVKLDVSVTEPCFTDEGLTENTTYRYYVTAYDEAGNE
SERSTELVVMTLANNITGLNAVVNVDGSILVSWNQVARAAAYELMIDEYESVCIYDTSYL
HTGLLPNTRHTYRVRVRYAGNDYGAWSEKKVVFSFPGKPLDVGADIIDDNSVRIFWNQVQ
GISKYNVYRDGELIAAEVKAVEFTDTGLTAGRDYEYEVRAVSGDSESVENQRVIVNTGTG
SISANTVLNENRVYKSFNLKSRIINLNGYRFKVEGDLVQSGGTLDVNGGRLEVTGNYTIS
GSSYLEMTEEEDYVLVRGDFETRSDNNHENKLTAGTLEVKGNFTRKAGVSANFKASGTHR
VVLSGEKQQTIDFSSTNIQQFNILENKNTSGKELIFKNSYNAKIFINNTSGLSPMTVEYH
DWNLTGNEVINGDLYIKGKTLNLAGKTLKVNGNLIQTGGYIGCKWRKIRGRGKLHNKRVF
IFEDDGR
Download sequence
Identical sequences A3DJW7
gi|125975529|ref|YP_001039439.1| 203119.Cthe_3050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]