SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125975573|ref|YP_001039483.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125975573|ref|YP_001039483.1|
Domain Number 1 Region: 25-182
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000051
Family CBM4/9 0.079
Further Details:      
 
Weak hits

Sequence:  gi|125975573|ref|YP_001039483.1|
Domain Number - Region: 299-399
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000108
Family APC10-like 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|125975573|ref|YP_001039483.1|
Sequence length 968
Comment glycosyl transferase family protein [Clostridium thermocellum ATCC 27405]
Sequence
MSKKLFKVCLILLISIQFIFSSPVFAESENLVKNPGFEEGNDESVYFWQTHCWEKAEGVT
EFFIDESVYHSGGKSACIVNHSENDSRYMQPIKVKGDTYYRLSCWVKTENVGTKTKGANI
SIEGSLDTSRDIRETSDNWEYLELYGKTSPNQETFTLTIGLGGYGNTNTGKIWIDDVEVV
ELESLPAGKTAINLDPKYTGGNQNTSENTGGKIFMIFIALIFFLILLAVIFVIFFKDKMP
GFNAKAAQTDKPAAKKNQKDNDEKWIKVKFDKIDFIIMGVMTLVYLCVALYNLGDFKVPT
TSWEPTLPGEYFTVDLGKEATLSRIYYYCGLGSNKYNPFSKLRVEYLNENQEFEYLATID
KKELQDIFKWKYVDTAPVTTTQLKFIVDSTGGAFNEIAIVEQNSKEPLKNIKIIDSVLED
ESKATIGNLFDEPDKFAFKPSYMNGMYFDEIYHARTAFEHIHRMSPYETTHPPLGKIFIA
LGILVFGMVPFGWRIVGTLFGVAMVPVMYMFGKKVFHDRFYAFCTAFLMMFDFMHFSQTR
IATIDSYVTLFVILMYYHMYDYFINKSYNTTLKESLKPLFLSGLFFGLGAASKWIAIYGA
AGLALLFFVNKGTEFWEYRKISTGKSKKKPLWIGDYPSNLGITIGACVLFFIIIPLVIYI
LSYIPYMLVPGDNKGITVFIENSKHMFEYHSKLEAEHPYQSAWWEWPIMAKPMAFYFGSD
LEPGMTSKIFTMGNPAVWWVGLLALLIVAIFALSKVNKNLVVLFTLAATTFGYVALPKTI
FTETLKAQSAELCWAVIFFALIAILLVLSKLDTDILITSAVSSVAFGTILYLFKDIERGD
AYLKSGNTQLIIWACLLICITLLFIGIYRYDKKMMVPLAGLIFQYVPWIAVPRIAFIYHY
FSIVPFLILLIVYVIKKAADKHSGVKYFACVYLGIVMALFILFYPGLSGLEVPTSYMRYL
KWFNTWYF
Download sequence
Identical sequences A3DK11
gi|125975573|ref|YP_001039483.1| 203119.Cthe_3095 WP_020458020.1.31213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]