SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125975574|ref|YP_001039484.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125975574|ref|YP_001039484.1|
Domain Number 1 Region: 29-179
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000108
Family CBM4/9 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|125975574|ref|YP_001039484.1|
Sequence length 311
Comment hypothetical protein Cthe_3096 [Clostridium thermocellum ATCC 27405]
Sequence
MFKKVVAIFTTMVLLIALTVVSCAENTNYIFNGSFELLIDGEPSNWMREAYDKSPGASNF
RVETEGAKFGEKYVTIINNKLNDSRYSQIVLVEENKKYKLSCYIKTENVSEEGKGANLSV
AEQTVTSKRIKGTTDDWEYVELYVITESGVDRIKVTVGLGGYSGMSTGKASFDNVTMEEV
ETIPEGAPRAVVKAQNTKKSSNNSNNTNNTKSSSSQNNENKNELGKVVLVMLIVGAIAVG
VAVYNTFRSNKKVSGNQGNASNNTGTNTNMTESAANKESAGNKEFSDNNESSHSKEDSSD
NSDSDNKESSD
Download sequence
Identical sequences A3DK12
gi|125975574|ref|YP_001039484.1| 203119.Cthe_3096 WP_003511598.1.16390 WP_003511598.1.19387 WP_003511598.1.20586 WP_003511598.1.31213 WP_003511598.1.55520 WP_003511598.1.60145 WP_003511598.1.6636 WP_003511598.1.6965 gi|385778013|ref|YP_005687178.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]