SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125975593|ref|YP_001039503.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125975593|ref|YP_001039503.1|
Domain Number 1 Region: 29-312
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 0.0000000000000415
Family Cellulases catalytic domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|125975593|ref|YP_001039503.1|
Sequence length 337
Comment hypothetical protein Cthe_3115 [Clostridium thermocellum ATCC 27405]
Sequence
MIIKDDHIFRMTDDTGMLQHSKYSLPDPNHGYTTDDNARALIMALMLYKKYGEKKYLDLV
YRYSSFLLNAQNEKGKFKNFMGYDRKWLEDEGSEDCFGRCLWAIGFALSGDFTPRGVKHA
LLEIFNKAMPHAANLSYLRGKAYSAIGLSFFDGDDSKELVFSIAQSLCCQYDEHKDGEWK
WFEDVVSYCNSVLPWSLLTAYKVTGEKRFLETAEESLDFLGKITFKDGYFKPVGCNGWFK
KGKEQAEFDEQPVEACEAVLTYLEAFELTGKTKYLEKAKICNAWYSGMNSKGIPLVDPET
GGCYDGLTQKGVNLNMGAESLVSYIISYLKMSEIKSL
Download sequence
Identical sequences A3DK31
WP_020458024.1.31213 gi|125975593|ref|YP_001039503.1| 203119.Cthe_3115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]