SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125975610|ref|YP_001039520.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125975610|ref|YP_001039520.1|
Domain Number 1 Region: 345-410
Classification Level Classification E-value
Superfamily Type I dockerin domain 8.44e-21
Family Type I dockerin domain 0.00033
Further Details:      
 
Weak hits

Sequence:  gi|125975610|ref|YP_001039520.1|
Domain Number - Region: 76-200
Classification Level Classification E-value
Superfamily PR-1-like 0.000126
Family PR-1-like 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|125975610|ref|YP_001039520.1|
Sequence length 411
Comment dockerin type I cellulosome protein [Clostridium thermocellum ATCC 27405]
Sequence
MKVKLKGTFLLLILIAALLFNTVCSSAAESVLQDRTIDDIVKRYQNNPFRINVSVSDIYE
IEPKAEPPYVAGKLKSDYLKEALNCVNFMRYLVGLPNDLVLDDNYNNYAQHGTVLLARLR
GIAHYPQKPGDMPDEFYNLAYKGTSSSSIAYGFSSLMDSIMAFMKDNNSELNLSTVGHRR
WLLNPGMEKTGFGQCGRYYCTYILDSVMGASVKFDFIAWPARNYMPVEYFNDASVPWSVN
LGSDYFSPSLNEVEVTLKRRSDNKVWIFNKDNIEEYGLFNVNNDYYGMTKCIIFRPKGIG
SYNKNDVFDVNIKGIRLSTDGPTEINYTVRFFSLKDAIAERERNFTYGDLNGDGRVNSTD
LAVMKRYLLKQVQISDIRPADLNGDGKANSTDYQLLKRYILKTIDIFPVEK
Download sequence
Identical sequences A3DK48
gi|385778051|ref|YP_005687216.1| Cth-2277 203119.Cthe_3132 WP_003511666.1.19387 WP_003511666.1.20586 WP_003511666.1.31213 WP_003511666.1.55520 WP_003511666.1.60145 WP_003511666.1.6636 WP_003511666.1.6965 gi|125975610|ref|YP_001039520.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]