SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125975614|ref|YP_001039524.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125975614|ref|YP_001039524.1|
Domain Number 1 Region: 2-231
Classification Level Classification E-value
Superfamily Subtilisin-like 1.14e-52
Family Subtilases 0.00011
Further Details:      
 
Domain Number 2 Region: 305-374
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000000000327
Family Type I dockerin domain 0.0034
Further Details:      
 
Domain Number 3 Region: 234-294
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000000000196
Family Type I dockerin domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|125975614|ref|YP_001039524.1|
Sequence length 375
Comment peptidase S8/S53 subtilisin kexin sedolisin [Clostridium thermocellum ATCC 27405]
Sequence
MDIGDHGTHCAGIIAGFGPNVKIASLKHLSGNKFKDLDNWVSTMIKAINYADAMDIKIVN
VSLGLHKSQIGDRPFDSQALNDAISNADLLFVTAAGNFNKNIDLPDDVIYPASCTAENII
TVANTDKDDKLYESSNYGVISVDLAAPGTDIRSTIPTHLAGEGGPYDIKTGTSMSAPHVA
GAAALLLSSNPSLTTQQLKDLILSSVDFLPDLQGKVATSGRLNVAKALRKIRTSVKIGDI
DGNGEISSIDYAILKSHLINSNLTFKQLAAADVDGNGYVNSIDLAILQMYLLGKGGTSDI
GKNRIYTYGDIDNNGIVDENDYILICNHINGTGQLSDASLFAADADGNNVIDQTDRILIE
KYITGRITHLPVGNQ
Download sequence
Identical sequences A3DK52
Cth-2248 203119.Cthe_3136 gi|125975614|ref|YP_001039524.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]