SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125975619|ref|YP_001039529.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125975619|ref|YP_001039529.1|
Domain Number 1 Region: 618-829
Classification Level Classification E-value
Superfamily SGNH hydrolase 3.24e-60
Family YxiM C-terminal domain-like 0.0092
Further Details:      
 
Domain Number 2 Region: 182-382
Classification Level Classification E-value
Superfamily SGNH hydrolase 1.68e-47
Family YxiM C-terminal domain-like 0.000000564
Further Details:      
 
Domain Number 3 Region: 34-177
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.38e-40
Family YxiM N-terminal domain-like 0.00000122
Further Details:      
 
Domain Number 4 Region: 479-603
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.94e-24
Family Family 6 carbohydrate binding module, CBM6 0.0067
Further Details:      
 
Domain Number 5 Region: 403-474
Classification Level Classification E-value
Superfamily Type I dockerin domain 1.47e-18
Family Type I dockerin domain 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|125975619|ref|YP_001039529.1|
Sequence length 831
Comment G-D-S-L lipolytic protein [Clostridium thermocellum ATCC 27405]
Sequence
MRKRKLGFSAVIFITIIAIFGCFLDLRISAAPNEYKFDFGAGPVEPGYIGVSASTAYSKS
RGYGFNTPWNMRDVAASGSGLTSDAVQFLTYGTKSENTFNVDLDNGLYEVKVTLGNTSRA
SVAAEGVYQIINMTGNCATDKFQIPITDGQLNILVTAGKEGTPFTLSALEIRKISDVPVT
NRTIYIGGDSTVCNYYPLDTSAQAGWGQMLHKFVDTNVFQIRNMASSGQFARGFRDDGQF
EAIMKYLKPGDIFILQFGINDTNSKNSTTEAQFKEIMTDMVVKAKATGATVVLSTPQGRA
TDFNSSNVHDSQGRWYRRATIEVAREQGVRLVDLNVLSSAYFTSIGPEATLALYMPGDTL
HPNREGATQLARIVAEELADLLKAPVATPTSGPSATPTPIPNSFIYGDVNGNGSIESTDC
VWVKRYLLKQIDSFPNENGARAADVNGNGTIDSTDYQLLKRFILKVINEFPVQKQKNEPV
IYQAEDAIIYNAILETVNAGYTGSCYVNYHNEVGGYIEWNVNAPSSGSYALIFRYANGTT
ANRPMRITVNGNIVKPSMDFVSTGAWTTWNEAGIVANLNQGNNVIRATAIASDGGPNVDY
LKVFSANAFQPVSEEKITIYIAGDSTVQTYNASYAPQAGWGQFLGQYFTSNVVIENRAIA
GRSSRSFVEEGRLDSILSVIKPGDYLFIQFGHNDADISKPERYSAPYTTYKEYLRKYVDG
ARQKGAIPVLITPVARLNYKNNAFVNDFPDYCTAMKQVAEEKNVKLIDLMTKSLNYYNSI
GYNETYKLFMVSVNNTDYTHFTEKGAQQIARLVAQGVKEANLDIAKYLKTN
Download sequence
Identical sequences A3DK57
203119.Cthe_3141 WP_020458033.1.31213 gi|125975619|ref|YP_001039529.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]