SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125975700|ref|YP_001039610.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|125975700|ref|YP_001039610.1|
Domain Number - Region: 32-109
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.0755
Family Papain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|125975700|ref|YP_001039610.1|
Sequence length 266
Comment hypothetical protein Cthe_3222 [Clostridium thermocellum ATCC 27405]
Sequence
MPSLDWNSDRYKNIGKDETCNNEDIVKTSLTNTDFLKIVDDGKVYYGGNQNWFQKYTQSF
GGCGPTAAANILAYMAMTDPKFAKLYEYDLKNITKADFVKFMEEVYKYVTPLEVPVFSHM
SDKKGKQAGIPSLGITGLAAFAKGVEKFAKSRGIKLKAKWSGEKPTFDNAVSYIREGLRK
NRPVALLNMFNPVSMQWSDPETSKIKSMTYERHWVTITGMIENRKTGEVTLEVSTWGGKA
TLSFNELYNNMDWNEMIFPAGIIYFE
Download sequence
Identical sequences A3DKD8
WP_020458060.1.31213 203119.Cthe_3222 gi|125975700|ref|YP_001039610.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]