SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|346980504|ref|YP_004849448.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|346980504|ref|YP_004849448.1|
Domain Number 1 Region: 24-67
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000398
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|346980504|ref|YP_004849448.1|
Sequence length 73
Comment hypothetical protein Cthe_3339 [Clostridium thermocellum ATCC 27405]
Sequence
MKIIEDENSGEVVIDNIRIEGFIYDEKCKKCNNFLVYYEKYDAFFCAYCNEWVESKCRDK
ECEFCKSRPEKPL
Download sequence
Identical sequences G2JC86
gi|346980504|ref|YP_004849448.1| 2005471078 WP_020458076.1.31213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]