SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125973062|ref|YP_001036972.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125973062|ref|YP_001036972.1|
Domain Number 1 Region: 29-479
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 5.44e-167
Family Cellulases catalytic domain 0.00000000000714
Further Details:      
 
Domain Number 2 Region: 484-638
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 1.52e-45
Family Cellulose-binding domain family III 0.00000944
Further Details:      
 
Domain Number 3 Region: 666-738
Classification Level Classification E-value
Superfamily Type I dockerin domain 1.18e-16
Family Type I dockerin domain 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|125973062|ref|YP_001036972.1|
Sequence length 739
Comment glycoside hydrolase family protein [Clostridium thermocellum ATCC 27405]
Sequence
MKKILAFLLTVALVAVVAIPQAVVSFAADFNYGEALQKAIMFYEFQRSGKLPENKRNNWR
GDSALNDGADNGLDLTGGWYDAGDHVKFNLPMAYAVTMLAWSVYESRDAYVQSGQLPYIL
DNIKWATDYFIKCHPSPNVYYYQVGDGALDHSWWGPAEVMQMPRPSFKVDLTNPGSTVVA
ETAAAMAASSIVFKPTDPEYAATLLRHAKELFTFADTTRSDAGYRAAEGYYSSHSGFYDE
LTWASIWLYLATGDQSYLDKAESYEPHWERERGTTLISYSWAHCWDNKLYGSLLLLAKIT
GKSYYKQCIENHLDYWTVGFNGSRVQYTPKGLAYLDRWGSLRYATTQAFLASVYADWSGC
DPAKAAVYKEFAKKQVDYALGSTGRSFVVGFGKNPPRNPHHRTAHSSWSALMTEPAECRH
ILVGALVGGPDGSDSYVDRLDDYQCNEVANDYNAGFVGALAKMYEKYGGEPIPNFVAFET
PGEEFYVEAAVNAAGPGFVNIKASIINKSGWPARGSDKLSAKYFVDISEAVAKGITLDQI
TVQSTTNGGAKVSQLLPWDPDNHIYYVNIDFTGINIFPGGINEYKRDVYFTITAPYGEGN
WDNTNDFSFQGLEQGFTSKKTEYIPLYDGNVRVWGKVPDGGSEPDPTPTITVGPTPSVTP
TSVPGIMLGDVNFDGRINSTDYSRLKRYVIKSLEFTDPEEHQKFIAAADVDGNGRINSTD
LYVLNRYILKLIEKFPAEQ
Download sequence
Identical sequences P26224
WP_003517595.1.16390 WP_003517595.1.19387 WP_003517595.1.20586 WP_003517595.1.31213 WP_003517595.1.55520 WP_003517595.1.60145 WP_003517595.1.6636 WP_003517595.1.6965 gi|385779037|ref|YP_005688202.1| gi|125973062|ref|YP_001036972.1| 203119.Cthe_0543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]