SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125973178|ref|YP_001037088.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125973178|ref|YP_001037088.1|
Domain Number 1 Region: 708-770
Classification Level Classification E-value
Superfamily Type I dockerin domain 3.24e-17
Family Type I dockerin domain 0.00046
Further Details:      
 
Weak hits

Sequence:  gi|125973178|ref|YP_001037088.1|
Domain Number - Region: 663-718
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 0.0667
Family Integrin alpha N-terminal domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|125973178|ref|YP_001037088.1|
Sequence length 773
Comment glycoside hydrolase family protein [Clostridium thermocellum ATCC 27405]
Sequence
MPPGAKVPQAEIYKTSNLQGAVPTNSWESSILWNQYSLPIYAHPLTFKFKAEGIEVGKPA
LGGSGIAYFGAHKNDFTVGHSSVYTFPDARADKISDFAVDAVMASGSGSIKATLMKGSPY
AYFVFTGGNPRIDFSGTPTVFYGDSGSQCLGVTINGVNYGLFAPSGSKWQGIGTGTITCI
LPAGKNYFSIAVLPDNTVSTLTYYKDYAYCFVTDTKVEWSYNETESTLTTTFTAEVSVKE
GTNKGTILALYPHQWRNNPHILPLPYTYSTLRGIMKTIQGTSFKTVYRYHGILPNLPDKG
TYDREALNRYINELALQADAPVAVDTYWFGKHLGKLSCALPIAEQLGNISAKDRFISFMK
SSLEDWFTAKEGETAKLFYYDSNWGTLIGYPSSYGSDEELNDHHFHYGYFLHAAAQIALR
DPQWASRDNWGAMVELLIKDIANWDRNDTRFPFLRNFDPYEGHSWASGHAGFADGNNQES
SSEAINAWQAIILWGEATGNKTIRDLGIYLYTTEVEAVCNYWFDLYKDIFSPSYGHNYAS
MVWGGKYCHEIWWNGTNSEKHGINFLPITAASLYLGKDPNYIKQNYEEMLRECGTSQPPN
WKDIQYMYYALYDPAAAKNMWNESIVPEDGESKAHTYHWICNLDSLGLPDFSVTADTPLY
SVFNKNNIRTYVVYNASSSAKKVTFSDGKVMTVGPHSMAVSTGSESEVLAGDLNGDGKIN
STDISLMKRYLLKQIVDLPVEDDIKAADINKDGKVNSTDMSILKRVILRNYPL
Download sequence
Identical sequences A3DD66
gi|125973178|ref|YP_001037088.1| 203119.Cthe_0660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]