SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125973316|ref|YP_001037226.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125973316|ref|YP_001037226.1|
Domain Number 1 Region: 11-224
Classification Level Classification E-value
Superfamily SGNH hydrolase 6.11e-34
Family Acetylhydrolase 0.012
Further Details:      
 
Domain Number 2 Region: 246-440
Classification Level Classification E-value
Superfamily SGNH hydrolase 3.36e-32
Family Acetylhydrolase 0.0087
Further Details:      
 
Domain Number 3 Region: 467-527
Classification Level Classification E-value
Superfamily Type I dockerin domain 6.38e-16
Family Type I dockerin domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|125973316|ref|YP_001037226.1|
Sequence length 528
Comment G-D-S-L lipolytic protein [Clostridium thermocellum ATCC 27405]
Sequence
MYKSKNLAAKVLSTLLIFITVISLINMEAPAASKTIKIMPVGDSCTEGMGGGEMGSYRTE
LYRLLTQAGLSIDFVGSQRSGPSSLPDKDHEGHSGWTIPQIASNINNWLNTHNPDVVFLW
IGGNDLLLNGNLNATGLSNLIDQIFTVKPNVTLFVADYYPWPEAIKQYNAVIPGIVQQKA
NAGKKVYFVKLSEIQFDRNTDISWDGLHLSEIGYKKIANIWYKYTIDILRALAGETQPNP
SPSSTPNTTKTIKIMPVGDSCTEGMGGGEMGSYRTELYRLLTQAGLSIDFVGSQRSGPSS
LPDKDHEGHSGWTIPQIASNINNWLNTHNPDVVFLWIGGNDLLLSGNVNATGLSNLIDQI
FTVKPNVTLFVADYYPWPEAVKQYNAVIPGIVQQKANAGKKVYFVKLSEIQFDRNTDISW
DGLHLSEIGYTKIANIWYKYTIDILKALAGQTQPTPSPSPTPTDSPLVKKGDVNLDGQVN
STDFSLLKRYILKVVDINSINVTNADMNNDGNINSTDISILKRILLRN
Download sequence
Identical sequences A3DDK4
gi|385778772|ref|YP_005687937.1| WP_011837904.1.19387 WP_011837904.1.20586 WP_011837904.1.31213 WP_011837904.1.6636 203119.Cthe_0798 gi|125973316|ref|YP_001037226.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]