SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125973339|ref|YP_001037249.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125973339|ref|YP_001037249.1|
Domain Number 1 Region: 32-308
Classification Level Classification E-value
Superfamily (Trans)glycosidases 7.24e-53
Family beta-glycanases 0.0000108
Further Details:      
 
Domain Number 2 Region: 344-468
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.69e-28
Family APC10-like 0.073
Further Details:      
 
Domain Number 3 Region: 482-551
Classification Level Classification E-value
Superfamily Type I dockerin domain 5.1e-17
Family Type I dockerin domain 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|125973339|ref|YP_001037249.1|
Sequence length 558
Comment coagulation factor 5/8 type-like protein [Clostridium thermocellum ATCC 27405]
Sequence
MKKRVCILLAVVILMTVSLPFVTLGADDIYPGLRVQGRFLYDKYGEKIILYGVNEMSIWG
DIDGDVALPEIRKTGANAVRLVWSVSGPARKLDILLYNCRINNMIPIIELHDATGEWQKL
SMLVDYWTRPDVLEVLKKHQEYLIINIGNEVGAQVSESEFKTGYEAAVKRMREAGIHVPL
MIDGSDWGKNIDILQATGPYLINADPDKNLLFSVHMWWPYMWGYNEQKVIDEIKESVEMG
LPLVVGEFGHQWEEHEMGKIPYKTIMEQCYKNEIGYLAWSWGPGNQPQTFLDMTTDGTFD
TLRGWGLEVCVTDPYSIMNIAVRPASMLEEPTTEPPVINIPAGSIAQNKPVYASSTEPGL
GNTPEKAVDGNIATRWSSDYSDNQYIYVDLLDEYEIERVYIEWEAAYARQYKIQVSNDAV
TWTDVYTEYNGDGDIDDIYLEARGRYVRIYCMQRATQYGNSIFELGVYPKGGIAEPTPPG
VEILVGDINRDGKINSTDLGMLNRHILKLVILDDNLKLAAADIDGNGNINSTDYSWLKKY
ILKVISEFPGGDTRIVTP
Download sequence
Identical sequences A3DDM7
gi|125973339|ref|YP_001037249.1| 203119.Cthe_0821 WP_004463379.1.16390 WP_004463379.1.31213 WP_004463379.1.60145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]